LXL04_022257 | RubberDandelionOmics

Gene overview

LXL04_022257

Reference: OH-1004 Chr: Chr04 Coordinates: 146982719-146983501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · LXL04_022257|LXL04_022257|OH1004|cDNA

ATGTCTGACGAAGGAGTTTACAACCaccccaccaccaccaccaccgccgtGGAGGTGGAGCCTGAGACCGTCCAGACGTCCGATCGTGGACTGTTTGATGTTTTTGGGAAGAAAAACGAAGAGAAGAAATGCGAAGAGGCCGCGATCTCATCGGAGTTTGAAGAGAAAGTTCAGGTCTCCGAACCGGTACCggaggagaagaaggaaactTTGCTCGATAAACTTCACAGATCCGGTAGCAGCAGTTCCAGTAGCTCGAG...

CDS

Download CDS FASTA

648 bp · LXL04_022257|LXL04_022257|OH1004|CDS

ATGTCTGACGAAGGAGTTTACAACCACCCCACCACCACCACCACCGCCGTGGAGGTGGAGCCTGAGACCGTCCAGACGTCCGATCGTGGACTGTTTGATGTTTTTGGGAAGAAAAACGAAGAGAAGAAATGCGAAGAGGCCGCGATCTCATCGGAGTTTGAAGAGAAAGTTCAGGTCTCCGAACCGGTACCGGAGGAGAAGAAGGAAACTTTGCTCGATAAACTTCACAGATCCGGTAGCAGCAGTTCCAGTAGCTCGAG...

Protein

Download Protein FASTA

215 aa · LXL04_022257|LXL04_022257|OH1004|PROTEIN

MSDEGVYNHPTTTTTAVEVEPETVQTSDRGLFDVFGKKNEEKKCEEAAISSEFEEKVQVSEPVPEEKKETLLDKLHRSGSSSSSSSSDEECDENGEKKKKKKPLKEKIKEKITKHEDETSVPIEKYDVAPLQHTPNPEPEEKKGFMEKIKEKLPGGHKKVEEEYVAPPPPPPTVVTHPDEGEQKKGIFEKIKEKIPGYHPKSEEEKEKEKEKECH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022257`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022257

Location Chr04:146982719-146983501 (+)

Description Similar to ECPP44: Phosphoprotein ECPP44

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20440`	Dehydrin COR47.	No verified direct reference in this release
`At1g20450`	Dehydrin ERD10.	No verified direct reference in this release
`At1g76180`	Intrinsically disordered protein acting as a chaperone.	Chaperone activity of ERD10 and ERD14, two disordered stress-related plant proteins.2008 · DOI: 10.1104/pp.108.118208

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022257 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009992 intracellular water homeostasis Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010286 heat acclimation Biological Process

GO:0050821 protein stabilization Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G20440

ath:AT1G20450

ath:AT1G76180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.477

Rank 1 · LXL04_022257 · OH-1004

Cell membrane0.450

Rank 2 · LXL04_022257 · OH-1004

Nucleus0.222

Rank 3 · LXL04_022257 · OH-1004

Golgi apparatus0.028

Rank 4 · LXL04_022257 · OH-1004

Mitochondrion0.028

Rank 5 · LXL04_022257 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257.25Dehydrin43-157 aa

PF00257.25Dehydrin142-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022257	`PF00257.25`	Dehydrin	43	157	1.2e-31	111.0
LXL04_022257	`PF00257.25`	Dehydrin	142	199	1.2e-31	111.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P31168`	Arabidopsis thaliana	Dehydrin COR47	41.152%	Swiss-Prot	moderate database homology
`P42759`	Arabidopsis thaliana	Dehydrin ERD10	38.496%	Swiss-Prot	moderate database homology
`P42763`	Arabidopsis thaliana	Dehydrin ERD14	44.199%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card