LXL04_022211 | RubberDandelionOmics

Gene overview

LXL04_022211

Reference: OH-1004 Chr: Chr04 Coordinates: 146167603-146168663 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · LXL04_022211|LXL04_022211|OH1004|cDNA

ATGAGGACAATGATAGATTTAGGAAGCGAAAGAGGACCAATGGGAATGCATATAATTACCTCAGCAACCGCCGTTGACTGTAGTAGCCGGGAAGTTGGACTCCGGCGATCTTTAAGATCCTTGATTGACTGCTTAATTCCTACTTGTTGTGCTTCTGGGTTTGATAATTCCGATCATCACTCCGCCAACTCTTCTCCGGATTCTACTTCTTCCTCGCCGTTTTCGAGCGATACAGATTCACCATCGTCGTCGTCTTCATC...

CDS

Download CDS FASTA

858 bp · LXL04_022211|LXL04_022211|OH1004|CDS

ATGAGGACAATGATAGATTTAGGAAGCGAAAGAGGACCAATGGGAATGCATATAATTACCTCAGCAACCGCCGTTGACTGTAGTAGCCGGGAAGTTGGACTCCGGCGATCTTTAAGATCCTTGATTGACTGCTTAATTCCTACTTGTTGTGCTTCTGGGTTTGATAATTCCGATCATCACTCCGCCAACTCTTCTCCGGATTCTACTTCTTCCTCGCCGTTTTCGAGCGATACAGATTCACCATCGTCGTCGTCTTCATC...

Protein

Download Protein FASTA

285 aa · LXL04_022211|LXL04_022211|OH1004|PROTEIN

MRTMIDLGSERGPMGMHIITSATAVDCSSREVGLRRSLRSLIDCLIPTCCASGFDNSDHHSANSSPDSTSSSPFSSDTDSPSSSSSSTVTRSLSSSSTTVKGTFFGQRNGRVSFCIQDDNHHHHRRTPSRRLTTTTTTTAMSSFSQPLFLLDFAIPTSYLAKEMQHGLLRIALVEENTTHRQQPPVIFDVPVWSMYCNGRKVGYATRRKMTAADTAILTRMQSVSVGAGVLPPENDHHGSDGIMYLRAGFRRIIGSPNSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022211`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022211

Location Chr04:146167603-146168663 (-)

Description Similar to MIZ1: Protein MIZU-KUSSEI 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41660`	Plays a role in lateral root development by maintaining auxin levels.	A gene essential for hydrotropism in roots.2007 · DOI: 10.1073/pnas.0609929104 Hormonal regulation of lateral root development in Arabidopsis modulated by MIZ1 and requirement of GNOM activity for MIZ1 function.2011 · DOI: 10.1104/pp.111.186270 MIZ1, an essential protein for root hydrotropism, is associated with the cytoplasmic face of the endoplasmic reticulum membrane in Arabidopsis root cells.2012 · DOI: 10.1016/j.febslet.2012.01.008 Light and abscisic acid signalling are integrated by MIZ1 gene expression and regulate hydrotropic response in roots of Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-3040.2012.02493.x Overexpression of MIZU-KUSSEI1 enhances the root hydrotropic response by retaining cell viability under hydrostimulated conditions in Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcs129

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022211 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0010274 hydrotropism Biological Process

GO:1901020 negative regulation of calcium ion transmembrane transporter activity Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0032541 cortical endoplasmic reticulum Cellular Component

GO:0019855 calcium channel inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT2G41660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.374

Rank 1 · LXL04_022211 · OH-1004

Cytoplasm0.309

Rank 2 · LXL04_022211 · OH-1004

Cell membrane0.277

Rank 3 · LXL04_022211 · OH-1004

Endoplasmic reticulum0.125

Rank 4 · LXL04_022211 · OH-1004

Mitochondrion0.079

Rank 5 · LXL04_022211 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04759.19DUF617100-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022211	`PF04759.19`	DUF617	100	282	1.6e-57	194.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22227`	Arabidopsis thaliana	Protein MIZU-KUSSEI 1	38.164%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card