LXL04_022143 | RubberDandelionOmics

Gene overview

LXL04_022143

Reference: OH-1004 Chr: Chr04 Coordinates: 145231906-145233366 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1461 bp · LXL04_022143|LXL04_022143|OH1004|cDNA

ATGGTGTCACTTTTGACATTTCTTGCATTCtctctctcaactctcttgttCCTGGTCTTTCTTAAAAGCAAACTTTACTGCACATGCCATGTCTGCCATTGCTATCTCAAATCTAAGTGGTCAACAGAGTATAACAATCTATGCGATTGGTACACTCATCTTCTCCAAAAGTCCTCATCTCAAACAATCCGTATTCATGTACTACGTAAAATCATCACAGCAAACCCTAACAACGTTGAACATATTCTCAAAACCAAGTT...

CDS

Download CDS FASTA

1461 bp · LXL04_022143|LXL04_022143|OH1004|CDS

ATGGTGTCACTTTTGACATTTCTTGCATTCTCTCTCTCAACTCTCTTGTTCCTGGTCTTTCTTAAAAGCAAACTTTACTGCACATGCCATGTCTGCCATTGCTATCTCAAATCTAAGTGGTCAACAGAGTATAACAATCTATGCGATTGGTACACTCATCTTCTCCAAAAGTCCTCATCTCAAACAATCCGTATTCATGTACTACGTAAAATCATCACAGCAAACCCTAACAACGTTGAACATATTCTCAAAACCAAGTT...

Protein

Download Protein FASTA

486 aa · LXL04_022143|LXL04_022143|OH1004|PROTEIN

MVSLLTFLAFSLSTLLFLVFLKSKLYCTCHVCHCYLKSKWSTEYNNLCDWYTHLLQKSSSQTIRIHVLRKIITANPNNVEHILKTKFHNYPKGKQFSMILSDLLGNGIFNVDGDSWLFQRKMASLQFGQVSNAFGNVSYQVQTRLLPLLSSTAGDQGDGGLVDLQSVFRHFLFDYICRFSLGVDLDSLELPFPSSQFSDSFDLATTLSAKRALYTSPMIWKANRILNMGSERKLKEAVKNVNFFVKKVIEHKKKSGCTKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022143`
TK1151 ID	TkA05G447050
OH-1004 ID	LXL04_022143
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.600
Protein coverage (%)	TK1151 97.222 / OH-1004 81.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022143

Location Chr04:145231906-145233366 (+)

Description Similar to CYP94C1: Cytochrome P450 94C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27690`	Involved in the oxidation of the plant hormone jasmonoyl-L- isoleucine (JA-Ile), a bioactive phytohormone of the jasmonate-mediated signaling pathway.	Characterization of a methyl jasmonate and wounding-responsive cytochrome P450 of Arabidopsis thaliana catalyzing dicarboxylic fatty acid formation in vitro.2007 · DOI: 10.1111/j.1742-4658.2007.06032.x Cytochromes P450 CYP94C1 and CYP94B3 catalyze two successive oxidation steps of plant hormone Jasmonoyl-isoleucine for catabolic turnover.2012 · DOI: 10.1074/jbc.m111.316364 Sequential oxidation of Jasmonoyl-Phenylalanine and Jasmonoyl-Isoleucine by multiple cytochrome P450 of the CYP94 family through newly identified aldehyde intermediates.2015 · DOI: 10.1016/j.phytochem.2015.06.027
`At3g48520`	May hydroxylate jasmonoyl-L-isoleucine in jasmonate signaling.	Cytochrome P450 CYP94B3 mediates catabolism and inactivation of the plant hormone jasmonoyl-L-isoleucine.2011 · DOI: 10.1073/pnas.1103542108 Arabidopsis CYP94B3 encodes jasmonyl-L-isoleucine 12-hydroxylase, a key enzyme in the oxidative catabolism of jasmonate.2011 · DOI: 10.1093/pcp/pcr110 Cytochromes P450 CYP94C1 and CYP94B3 catalyze two successive oxidation steps of plant hormone Jasmonoyl-isoleucine for catabolic turnover.2012 · DOI: 10.1074/jbc.m111.316364
`At5g63450`	Hydroxylase involved in the oxidation of the plant hormone jasmonoyl-L-isoleucine (JA-Ile), a bioactive phytohormone of the jasmonate-mediated signaling pathway.	Endoplasmic reticulum-associated inactivation of the hormone jasmonoyl-L-isoleucine by multiple members of the cytochrome P450 94 family in Arabidopsis.2014 · DOI: 10.1074/jbc.m114.603084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022143 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006694 steroid biosynthetic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0010154 fruit development Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0048480 stigma development Biological Process

GO:0048653 anther development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ag:AAD10204

ath:AT2G27690

ath:AT3G48520

ath:AT5G63450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.912

Rank 1 · LXL04_022143 · OH-1004

Cytoplasm0.055

Rank 2 · LXL04_022143 · OH-1004

Golgi apparatus0.042

Rank 3 · LXL04_022143 · OH-1004

Nucleus0.041

Rank 4 · LXL04_022143 · OH-1004

Cell membrane0.036

Rank 5 · LXL04_022143 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45070-463 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022143	`PF00067.28`	p450	70	463	6.6e-59	200.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUX1`	Arabidopsis thaliana	Cytochrome P450 94C1	54.526%	Swiss-Prot	strong database homology
`Q9SMP5`	Arabidopsis thaliana	Cytochrome P450 94B3	47.692%	Swiss-Prot	moderate database homology
`Q9FMV7`	Arabidopsis thaliana	Cytochrome P450 94B1	47.033%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card