Gene Card
Gene overview
cDNA / CDS / Protein Sequences
843 bp · LXL04_022016|LXL04_022016|OH1004|cDNA
ATGGATGACCAAATCAACCCCATCAGCAAAACCTCCGGCGCCGTGAAGGTCAACAACGGCGGATTACAACAACAATTGTTAGAGACGAGCAAATCAGAGAAACACGTATGGCTCATGAAATGCCCTCCGATTGTGTCTCGTTCACTTacgcaacaacaaccacaatTTTCGACGCCTATCGATGCTTCTTCAGCTCCAATCGGCGCCAAGGTTATCGTCACCGTTGATCCTCTCCTCCCTAACAACGATTCTCAGTTTAC...
843 bp · LXL04_022016|LXL04_022016|OH1004|CDS
ATGGATGACCAAATCAACCCCATCAGCAAAACCTCCGGCGCCGTGAAGGTCAACAACGGCGGATTACAACAACAATTGTTAGAGACGAGCAAATCAGAGAAACACGTATGGCTCATGAAATGCCCTCCGATTGTGTCTCGTTCACTTACGCAACAACAACCACAATTTTCGACGCCTATCGATGCTTCTTCAGCTCCAATCGGCGCCAAGGTTATCGTCACCGTTGATCCTCTCCTCCCTAACAACGATTCTCAGTTTAC...
Protein
Download Protein FASTA280 aa · LXL04_022016|LXL04_022016|OH1004|PROTEIN
MDDQINPISKTSGAVKVNNGGLQQQLLETSKSEKHVWLMKCPPIVSRSLTQQQPQFSTPIDASSAPIGAKVIVTVDPLLPNNDSQFTMELLGTESGRVPKCYSMDMSTDFIPMSVFCESKQGRLSVEGKIYHKFDMKPHNENIEEYGKLCRERTNKYMTKTRQIQVIDNDNGAHMRPMPGLIAFRPPSQTQRKKTPVKGSDTKRTRRDRGEMQDIMFKLFEGQSNWTLKQLISETDQPEQFLKDLLKDLCIYNNKGSNQG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_022016 |
|---|---|
| TK1151 ID | TkA05G439170 |
| OH-1004 ID | LXL04_022016 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.300 |
| Protein coverage (%) | TK1151 87.500 / OH-1004 50.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_022016 |
|---|---|
| Location | Chr04:142460617-142462272 (+) |
| Description | Similar to tfg2: Transcription initiation factor IIF subunit beta (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006366 transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005674 transcription factor TFIIF complex Cellular Component GO:0005675 transcription factor TFIIH holo complex Cellular Component GO:0015630 microtubule cytoskeleton Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0003677 DNA binding Molecular Function |
| KEGG gene cross-reference | bta:509259 ddi:DDB_G0287131 hsa:2963 mmu:68705 spo:2539924 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02270.23TFIIF_beta205-269 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_022016 | PF02270.23 | TFIIF_beta | 205 | 269 | 5.1e-18 | 65.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.