LXL04_022010 | RubberDandelionOmics

Gene overview

LXL04_022010

Reference: OH-1004 Chr: Chr04 Coordinates: 142403776-142415596 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2502 bp · LXL04_022010|LXL04_022010|OH1004|cDNA

ATGGCTCTTAAAGATCATCTTTCTTTTCTCGAGGAACCACTAGTATATCAAAACCCTTACGCCACCATGCAAGATAATCGTGACGATGATTCAGAAGAGACTATTTCTCTCTCTGATCTTCTCGTTTATGGCCGTGATACTAATTATAGCGCTACTGATTCTGAAGACTCCACGATAGGCGATGAAAGCTTTGAGTTTTTCAGTGAAGAGTTGGTCAAGCAGGTTAAAGATTCGCAAATAAAGGAAAGCATCGTTTTTTG...

CDS

Download CDS FASTA

2502 bp · LXL04_022010|LXL04_022010|OH1004|CDS

ATGGCTCTTAAAGATCATCTTTCTTTTCTCGAGGAACCACTAGTATATCAAAACCCTTACGCCACCATGCAAGATAATCGTGACGATGATTCAGAAGAGACTATTTCTCTCTCTGATCTTCTCGTTTATGGCCGTGATACTAATTATAGCGCTACTGATTCTGAAGACTCCACGATAGGCGATGAAAGCTTTGAGTTTTTCAGTGAAGAGTTGGTCAAGCAGGTTAAAGATTCGCAAATAAAGGAAAGCATCGTTTTTTG...

Protein

Download Protein FASTA

833 aa · LXL04_022010|LXL04_022010|OH1004|PROTEIN

MALKDHLSFLEEPLVYQNPYATMQDNRDDDSEETISLSDLLVYGRDTNYSATDSEDSTIGDESFEFFSEELVKQVKDSQIKESIVFCGNLILPKQPISRNTQEFNKQDHRSMEVDRNSGRNTMKAMNKGRNHGETNSTKRVLPALGSKKSRWYSYGVGLAGIPAEMDLSGIRSRQNRRQQNRSVRIQGGGEKEENGGSRHGKSLGRLIRDLSCSSQSQANGMVKASLVYIPRKSTKPKITEKPVEIVPLPQPTSTSSSSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022010`
TK1151 ID	TkA05G438940
OH-1004 ID	LXL04_022010
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 14.046 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022010

Location Chr04:142403776-142415596 (-)

Description Similar to At4g39280: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39280`	Phenylalanine--tRNA ligase alpha subunit, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022010 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006432 phenylalanyl-tRNA aminoacylation Biological Process

GO:0051290 protein heterotetramerization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009328 phenylalanine-tRNA ligase complex Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0000287 magnesium ion binding Molecular Function

GO:0004826 phenylalanine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G39280

dre:692329

rno:288917

xla:380545

xla:447019

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.379

Rank 1 · LXL04_022010 · OH-1004

Nucleus0.346

Rank 2 · LXL04_022010 · OH-1004

Cell membrane0.294

Rank 3 · LXL04_022010 · OH-1004

Endoplasmic reticulum0.094

Rank 4 · LXL04_022010 · OH-1004

Mitochondrion0.064

Rank 5 · LXL04_022010 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01409.26tRNA-synt_2d742-818 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022010	`PF01409.26`	tRNA-synt_2d	742	818	7.7e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T034`	Arabidopsis thaliana	Phenylalanine--tRNA ligase alpha subunit, cytoplasmic	72.277%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card