LXL04_021999 | RubberDandelionOmics

Gene overview

LXL04_021999

Reference: OH-1004 Chr: Chr04 Coordinates: 142253482-142256809 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_021999|LXL04_021999|OH1004|cDNA

ATGCCCTTCACCCTCCTCAAACTCACAACCGTATATTCGATTTCCCTCCACCACCGGCGTCAATACTGGTGGCTAGGTCGCGCAATCGCCACCGGGAGGTCTAAGACGCCACCTCCGATGTGCTCGAGCTGGTGGAGGACAACAACCTGTGTGACCCCAGCGCACGATAATAATAGCAACGAAAATAACAGTAATAACAGACTAGGGTTTCGTGGTCAGAAAAATTTGAGATATACGTCTAAAGATAAAGTAGGAGGAAA...

CDS

Download CDS FASTA

1017 bp · LXL04_021999|LXL04_021999|OH1004|CDS

ATGCCCTTCACCCTCCTCAAACTCACAACCGTATATTCGATTTCCCTCCACCACCGGCGTCAATACTGGTGGCTAGGTCGCGCAATCGCCACCGGGAGGTCTAAGACGCCACCTCCGATGTGCTCGAGCTGGTGGAGGACAACAACCTGTGTGACCCCAGCGCACGATAATAATAGCAACGAAAATAACAGTAATAACAGACTAGGGTTTCGTGGTCAGAAAAATTTGAGATATACGTCTAAAGATAAAGTAGGAGGAAA...

Protein

Download Protein FASTA

338 aa · LXL04_021999|LXL04_021999|OH1004|PROTEIN

MPFTLLKLTTVYSISLHHRRQYWWLGRAIATGRSKTPPPMCSSWWRTTTCVTPAHDNNSNENNSNNRLGFRGQKNLRYTSKDKVGGNAFNGGRVSMGSVNNDNRDDKRTTENDRGSGVASTLSSDNHRHLKPAPSKQNPSTKLLTLPTILTIGRVAAIPVIVCTFYMNSRLGTTVTTGIFIAAAITDWLDGYLARKMNLGTAFGAFLDPVADKLMVATTLVLLCTKPPEASMLGDLPWLLTVPSIAVIGREITMSAVREW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021999`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021999

Location Chr04:142253482-142256809 (+)

Description Similar to PGPS2: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55030`	Catalyzes the committed step to the synthesis of the acidic phospholipids, including phosphatidylglycerol (PG).	No verified direct reference in this release
`At2g39290`	Catalyzes the committed step to the synthesis of the acidic phospholipids, including phosphatidylglycerol (PG).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0283600`	Catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021999 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006655 phosphatidylglycerol biosynthetic process Biological Process

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0046474 glycerophospholipid biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G39290

ath:AT3G55030

dosa:Os03g0283600

sec:SCH_1948

stm:STM1945

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.905

Rank 1 · LXL04_021999 · OH-1004

Cytoplasm0.039

Rank 2 · LXL04_021999 · OH-1004

Nucleus0.037

Rank 3 · LXL04_021999 · OH-1004

Plastid0.035

Rank 4 · LXL04_021999 · OH-1004

Cell membrane0.024

Rank 5 · LXL04_021999 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01066.27CDP-OH_P_transf145-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021999	`PF01066.27`	CDP-OH_P_transf	145	303	1e-29	104.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2W3`	Arabidopsis thaliana	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 2	66.809%	Swiss-Prot	moderate database homology
`O80952`	Arabidopsis thaliana	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic/mitochondrial	77.551%	Swiss-Prot	moderate database homology
`Q8H8U0`	Oryza sativa subsp. japonica	Cardiolipin synthase (CMP-forming)	74.074%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card