LXL04_021996 | RubberDandelionOmics

Gene overview

LXL04_021996

Reference: OH-1004 Chr: Chr04 Coordinates: 142238465-142241705 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2109 bp · LXL04_021996|LXL04_021996|OH1004|cDNA

ATGAGGAGTATCACAGTGAACAGGAATGCTCCGGCAACTAGAGGGTTAGCCGAGCTCAACCACCATAACCGGGAGGAACTCAAGCAAGTCAGAAATGGAACCGCTCTTAATGGTCAATGGCTGTCTGAAGAAGACGAGACAAAAATCAACGAAGATGTCAACAGTGGTAGACAATTTGAGCTAATTCAGCCACACGATGCTCTCCATAGACAACATCAACCACATCAACCACATCAAGGCTCCATGGTTGAATGGGAACG...

CDS

Download CDS FASTA

2109 bp · LXL04_021996|LXL04_021996|OH1004|CDS

ATGAGGAGTATCACAGTGAACAGGAATGCTCCGGCAACTAGAGGGTTAGCCGAGCTCAACCACCATAACCGGGAGGAACTCAAGCAAGTCAGAAATGGAACCGCTCTTAATGGTCAATGGCTGTCTGAAGAAGACGAGACAAAAATCAACGAAGATGTCAACAGTGGTAGACAATTTGAGCTAATTCAGCCACACGATGCTCTCCATAGACAACATCAACCACATCAACCACATCAAGGCTCCATGGTTGAATGGGAACG...

Protein

Download Protein FASTA

702 aa · LXL04_021996|LXL04_021996|OH1004|PROTEIN

MRSITVNRNAPATRGLAELNHHNREELKQVRNGTALNGQWLSEEDETKINEDVNSGRQFELIQPHDALHRQHQPHQPHQGSMVEWERFLPLRSLKVLLVENDDSTRHIVSALLRNCSYEVTAVANGIEAWKVLIDLNKQIDIVLTEVLMPYLSGIGLLTKIMNHVPRKNVPVIMMSSDDSMGIVFNCLSKGAVDFLVKPIRKNELKNLWQHVWRKCHSQSSGSGSESGIGTRKSAKSLTNKESDDDDDVDDDDSDTSDED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021996`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021996

Location Chr04:142238465-142241705 (+)

Description Similar to APRR7: Two-component response regulator-like APRR7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02810`	Transcriptional repressor of CCA1 and LHY, and positive regulator of LWD1 and LWD2 expression.	Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFB7`	Controls photoperiodic flowering response.	No verified direct reference in this release
`Os03g0284100`	Controls photoperiodic flowering response.	No verified direct reference in this release
`UniProt: A2YQ93`	Controls photoperiodic flowering response.	No verified direct reference in this release
`Os07g0695100`	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions.	Natural variation in OsPRR37 regulates heading date and contributes to rice cultivation at a wide range of latitudes.2013 · DOI: 10.1093/mp/sst088 Days to heading 7, a major quantitative locus determining photoperiod sensitivity and regional adaptation in rice.2014 · DOI: 10.1073/pnas.1418204111

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021996 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048511 rhythmic process Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G02810

dosa:Os03g0284100

dosa:Os07g0695100

osa:4344399

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · LXL04_021996 · OH-1004

Cytoplasm0.099

Rank 2 · LXL04_021996 · OH-1004

Cell membrane0.052

Rank 3 · LXL04_021996 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_021996 · OH-1004

Plastid0.010

Rank 5 · LXL04_021996 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072.31Response_reg96-207 aa

PF06203.20CCT647-689 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021996	`PF00072.31`	Response_reg	96	207	3.7e-19	69.7
LXL04_021996	`PF06203.20`	CCT	647	689	1.2e-17	64.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WK5`	Arabidopsis thaliana	Two-component response regulator-like APRR7	43.001%	Swiss-Prot	moderate database homology
`A2XFB7`	Oryza sativa subsp. indica	Two-component response regulator-like PRR73	41.032%	Swiss-Prot	moderate database homology
`Q10N34`	Oryza sativa subsp. japonica	Two-component response regulator-like PRR73	40.774%	Swiss-Prot	moderate database homology
`A2YQ93`	Oryza sativa subsp. indica	Two-component response regulator-like PRR37	41.560%	Swiss-Prot	moderate database homology
`Q0D3B6`	Oryza sativa subsp. japonica	Two-component response regulator-like PRR37	41.727%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card