LXL04_021967 | RubberDandelionOmics

Gene overview

LXL04_021967

Reference: OH-1004 Chr: Chr04 Coordinates: 141569342-141576839 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4122 bp · LXL04_021967|LXL04_021967|OH1004|cDNA

ATGATGTCACGAGGTTTATTTGGTTGGTCACCGCCGCGACAACAGCCTCTAACGCCGGTATCGGAGGTGTCGGAGTGTCCGTCTCCTTACGTAGACACGAGCCAAGATGCGGTACCTACAGAAATTGAGGATGTAGTGGAGGAAACGGAGGAGATCGAGCCGCCTCCTGAAACAGTGCCGTTTTCGAGACTTTTTGCCTGTGCTGATAAGCTTGATTGGATGCTTATGATAGTTGGATCGGTTGCTGCGGCGGCGCATGG...

CDS

Download CDS FASTA

4122 bp · LXL04_021967|LXL04_021967|OH1004|CDS

ATGATGTCACGAGGTTTATTTGGTTGGTCACCGCCGCGACAACAGCCTCTAACGCCGGTATCGGAGGTGTCGGAGTGTCCGTCTCCTTACGTAGACACGAGCCAAGATGCGGTACCTACAGAAATTGAGGATGTAGTGGAGGAAACGGAGGAGATCGAGCCGCCTCCTGAAACAGTGCCGTTTTCGAGACTTTTTGCCTGTGCTGATAAGCTTGATTGGATGCTTATGATAGTTGGATCGGTTGCTGCGGCGGCGCATGG...

Protein

Download Protein FASTA

1373 aa · LXL04_021967|LXL04_021967|OH1004|PROTEIN

MMSRGLFGWSPPRQQPLTPVSEVSECPSPYVDTSQDAVPTEIEDVVEETEEIEPPPETVPFSRLFACADKLDWMLMIVGSVAAAAHGTALVVYLHYFAKIIQLLSHGDESSDVLFDRFKELALTLLYIACGVFAAGWIEVSCWILTGERQTAVIRSSYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIGFLNCWQIAGLTLLTGPFIVAAGGISNIFLHRLAENIQDAYSEAAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021967`
TK1151 ID	TkA05G435990
OH-1004 ID	LXL04_021967
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.500
Protein coverage (%)	TK1151 99.829 / OH-1004 48.434 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021967

Location Chr04:141569342-141576839 (+)

Description Similar to ABCB20: ABC transporter B family member 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55320`	Probable auxin efflux transporter that contributes, together with ABCB6 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At2g39480`	Probable auxin efflux transporter that contributes, together with ABCB20 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At2g36910`	May participate in brassinosteroid export and related signaling.	Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181
`At1g10680`	ABC transporter B family member 10.	No verified direct reference in this release
`At2g47000`	Auxin influx transporter that mediates the transport of auxin in roots.	PGP4, an ATP binding cassette P-glycoprotein, catalyzes auxin transport in Arabidopsis thaliana roots.2005 · DOI: 10.1105/tpc.105.035816

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021967 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008361 regulation of cell size Biological Process

GO:0009555 pollen development Biological Process

GO:0009624 response to nematode Biological Process

GO:0009637 response to blue light Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

KEGG gene cross-reference

ath:AT1G10680

ath:AT2G36910

ath:AT2G39480

ath:AT3G55320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.417

Rank 1 · LXL04_021967 · OH-1004

Lysosome / Vacuole0.279

Rank 2 · LXL04_021967 · OH-1004

Endoplasmic reticulum0.155

Rank 3 · LXL04_021967 · OH-1004

Cytoplasm0.134

Rank 4 · LXL04_021967 · OH-1004

Golgi apparatus0.090

Rank 5 · LXL04_021967 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane77-348 aa

PF00005.34ABC_tran422-567 aa

PF00664.29ABC_membrane805-1070 aa

PF00005.34ABC_tran1142-1290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021967	`PF00664.29`	ABC_membrane	77	348	1.2e-80	271.9
LXL04_021967	`PF00005.34`	ABC_tran	422	567	1.1e-54	185.4
LXL04_021967	`PF00664.29`	ABC_membrane	805	1070	1.2e-80	271.9
LXL04_021967	`PF00005.34`	ABC_tran	1142	1290	1.1e-54	185.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3B9`	Arabidopsis thaliana	ABC transporter B family member 20	77.347%	Swiss-Prot	strong database homology
`Q8LPT1`	Arabidopsis thaliana	ABC transporter B family member 6	77.347%	Swiss-Prot	strong database homology
`Q9ZR72`	Arabidopsis thaliana	ABC transporter B family member 1	40.506%	Swiss-Prot	moderate database homology
`Q9SGY1`	Arabidopsis thaliana	ABC transporter B family member 10	39.350%	Swiss-Prot	moderate database homology
`O80725`	Arabidopsis thaliana	ABC transporter B family member 4	37.710%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card