Gene Card
Gene overview
cDNA / CDS / Protein Sequences
915 bp · LXL04_021854|LXL04_021854|OH1004|cDNA
ATGGTGGAGCTTGGTCAAACAGATACCGAAGTATACACGCCGAAGAAGACCTTACACGTATGGCGGACACTGTTGAACTGGTTGGCTTTCTTCTTCCAGATCTTCGTTCAGATCATTAAAGCAACTCCTTCCTTGATTAACTATTCTTCTTCGTCTTCGTCGTCGTCGTTTGAGCCTTTGCCGGTCGTTGAATTGTCTGAATCTCCCGAACCTCCGTCTCCGTACGCCGCCTCTGCCGTTCATATTCCGTCGGTTGATGC...
915 bp · LXL04_021854|LXL04_021854|OH1004|CDS
ATGGTGGAGCTTGGTCAAACAGATACCGAAGTATACACGCCGAAGAAGACCTTACACGTATGGCGGACACTGTTGAACTGGTTGGCTTTCTTCTTCCAGATCTTCGTTCAGATCATTAAAGCAACTCCTTCCTTGATTAACTATTCTTCTTCGTCTTCGTCGTCGTCGTTTGAGCCTTTGCCGGTCGTTGAATTGTCTGAATCTCCCGAACCTCCGTCTCCGTACGCCGCCTCTGCCGTTCATATTCCGTCGGTTGATGC...
Protein
Download Protein FASTA304 aa · LXL04_021854|LXL04_021854|OH1004|PROTEIN
MVELGQTDTEVYTPKKTLHVWRTLLNWLAFFFQIFVQIIKATPSLINYSSSSSSSSFEPLPVVELSESPEPPSPYAASAVHIPSVDAAYDVSQKLTVVLDLDETLVCAYETSSLPVIVRNQAIDAGLKWFELECLSSDKESEGKPKINYVTVFERPGLHEFLTQLSLFADLVLFTAGLEGYAKPLVDRIDAENRFSSRLYRPSTSSTEFREHVKDLSCISRNFSRIVIVDNNPFSFLLQPVNGIPCIPFSAGQPHDSQLL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021854 |
|---|---|
| TK1151 ID | TkA05G430760 |
| OH-1004 ID | LXL04_021854 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021854 |
|---|---|
| Location | Chr04:138700207-138702726 (+) |
| Description | Similar to PSR2: Probable phosphatase PSR2 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001933 negative regulation of protein phosphorylation Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006470 protein dephosphorylation Biological Process GO:0009651 response to salt stress Biological Process GO:0034198 cellular response to amino acid starvation Biological Process GO:0034605 cellular response to heat Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1904262 negative regulation of TORC1 signaling Biological Process GO:2000134 negative regulation of G1/S transition of mitotic cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | hsa:10217 hsa:58190 mmu:227292 mmu:69274 sce:YLR019W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03031.25NIF95-277 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021854 | PF03031.25 | NIF | 95 | 277 | 5.6e-41 | 140.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.