LXL04_021798 | RubberDandelionOmics

Gene overview

LXL04_021798

Reference: OH-1004 Chr: Chr04 Coordinates: 137111283-137113886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2445 bp · LXL04_021798|LXL04_021798|OH1004|cDNA

ATGGTTGATGATATGGCATGGATTTCTCGCCTTTCGTCACTTGCGCATCTCGACTTGAGTGAAGCAGATCTTGGTGGAGCAAGAAACTGGGAAACAGTGTTTTACATAATTCCTTCGTTACAAGTGTTAGGTTTGTCAAATTGTGGACTTTCTAATGTTGATCTTCATTTTTTTCTAAATTCGAGTAGAATAGTTCCCAACATCAAACACCTCGATCTTAGCTTCAATTCGTTCGAAGGTCCACTCCCTGGATTTTTTCA...

CDS

Download CDS FASTA

2445 bp · LXL04_021798|LXL04_021798|OH1004|CDS

ATGGTTGATGATATGGCATGGATTTCTCGCCTTTCGTCACTTGCGCATCTCGACTTGAGTGAAGCAGATCTTGGTGGAGCAAGAAACTGGGAAACAGTGTTTTACATAATTCCTTCGTTACAAGTGTTAGGTTTGTCAAATTGTGGACTTTCTAATGTTGATCTTCATTTTTTTCTAAATTCGAGTAGAATAGTTCCCAACATCAAACACCTCGATCTTAGCTTCAATTCGTTCGAAGGTCCACTCCCTGGATTTTTTCA...

Protein

Download Protein FASTA

814 aa · LXL04_021798|LXL04_021798|OH1004|PROTEIN

MVDDMAWISRLSSLAHLDLSEADLGGARNWETVFYIIPSLQVLGLSNCGLSNVDLHFFLNSSRIVPNIKHLDLSFNSFEGPLPGFFQNLSSLTFLDLSSFNLSLAWNFEHLLTMNPSLWELHFSDCGLDKTQLSSPRLNFNTISNIQYLVLSNNSIEGKFPSFFTNMSSLRNSSVPIMPNLLYLDLSNNHFKQIGDIGIERQCHLKRLHASYNHFEKDVSNSPKNVSECSQYALKWLDLSESLNGIIPKPFGRLHNLRGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021798`
TK1151 ID	TkA05G421890
OH-1004 ID	LXL04_021798
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.000
Protein coverage (%)	TK1151 94.074 / OH-1004 40.663 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021798

Location Chr04:137111283-137113886 (-)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11010`	Receptor-like protein 34.	No verified direct reference in this release
`At5g27060`	Receptor-like protein 53.	No verified direct reference in this release
`At2g15080`	Receptor-like protein 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021798 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.848

Rank 1 · LXL04_021798 · OH-1004

Endoplasmic reticulum0.096

Rank 2 · LXL04_021798 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_021798 · OH-1004

Nucleus0.049

Rank 4 · LXL04_021798 · OH-1004

Extracellular0.028

Rank 5 · LXL04_021798 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_838-99 aa

PF23598.2LRR_14232-336 aa

PF13855.13LRR_8478-535 aa

PF23598.2LRR_14528-606 aa

PF23598.2LRR_14676-756 aa

PF13855.13LRR_8705-740 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021798	`PF13855.13`	LRR_8	38	99	4.1e-46	155.3
LXL04_021798	`PF23598.2`	LRR_14	232	336	1.4e-18	67.5
LXL04_021798	`PF13855.13`	LRR_8	478	535	4.1e-46	155.3
LXL04_021798	`PF23598.2`	LRR_14	528	606	1.4e-18	67.5
LXL04_021798	`PF23598.2`	LRR_14	676	756	1.4e-18	67.5
LXL04_021798	`PF13855.13`	LRR_8	705	740	4.1e-46	155.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRL2`	Arabidopsis thaliana	Receptor-like protein 34	32.019%	Swiss-Prot	moderate database homology
`Q9S9U3`	Arabidopsis thaliana	Receptor-like protein 53	31.856%	Swiss-Prot	moderate database homology
`Q9ZUK3`	Arabidopsis thaliana	Receptor-like protein 19	30.699%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card