LXL04_021705 | RubberDandelionOmics

Gene overview

LXL04_021705

Reference: OH-1004 Chr: Chr04 Coordinates: 135618185-135621305 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_021705|LXL04_021705|OH1004|cDNA

ATGGGATTGGGTTCCCCTAAATCAATGGCTGCATATCCAAAGAAACTTTTACCAATAGCAGCTTCAGTAGGGGGACTTGCCTTGTTCTTAATTTTTGCCTCTTTGCTTCTTGTATATCAGCCAATTGGATCTAAAGTTAGTGGCTACTTTTATAACCTAGATCAAGCTAGCAAAACCACGTTATCACCCTTTAATAATGATCCAAGCATATTTGAGATCAGGGTTAATGATACAGAAACAGATAGAAAAATTGTTGATTC...

CDS

Download CDS FASTA

1743 bp · LXL04_021705|LXL04_021705|OH1004|CDS

ATGGGATTGGGTTCCCCTAAATCAATGGCTGCATATCCAAAGAAACTTTTACCAATAGCAGCTTCAGTAGGGGGACTTGCCTTGTTCTTAATTTTTGCCTCTTTGCTTCTTGTATATCAGCCAATTGGATCTAAAGTTAGTGGCTACTTTTATAACCTAGATCAAGCTAGCAAAACCACGTTATCACCCTTTAATAATGATCCAAGCATATTTGAGATCAGGGTTAATGATACAGAAACAGATAGAAAAATTGTTGATTC...

Protein

Download Protein FASTA

580 aa · LXL04_021705|LXL04_021705|OH1004|PROTEIN

MGLGSPKSMAAYPKKLLPIAASVGGLALFLIFASLLLVYQPIGSKVSGYFYNLDQASKTTLSPFNNDPSIFEIRVNDTETDRKIVDSGTDNTVDSGINNAADSDAKKTIDSDTNKTIGSDIDKTADSVVNKTIDSDINKTFDSDTNKTIDSDIDKTVDSVVNKTIDSDTKKTTESDINKTVDSGIDKITESDINKTVDLDINKTADTNTKKSVDPGCDLYDGKWVHDLIGPLYTNNSCPVLTQMQNCQGNGRPDKDYENW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021705`
TK1151 ID	TkA05G416620
OH-1004 ID	LXL04_021705
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.500
Protein coverage (%)	TK1151 81.953 / OH-1004 68.276 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021705

Location Chr04:135618185-135621305 (+)

Description Similar to TBL18: Protein trichome birefringence-like 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25360`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g51640`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g70230`	Xyloglucan acetyltransferase that catalyzes the acetylation of fucosylated Gal residues on xyloglucan side chains.	O-acetylation of Arabidopsis hemicellulose xyloglucan requires AXY4 or AXY4L, proteins with a TBL and DUF231 domain.2011 · DOI: 10.1105/tpc.111.091728 Xyloglucan O-acetyltransferases from Arabidopsis thaliana and Populus trichocarpa catalyze acetylation of fucosylated galactose residues on xyloglucan side chains.2018 · DOI: 10.1007/s00425-018-2972-0
`At4g11090`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At4g23790`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021705 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010150 leaf senescence Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G70230

ath:AT4G11090

ath:AT4G25360

ath:AT5G51640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.268

Rank 1 · LXL04_021705 · OH-1004

Extracellular0.171

Rank 2 · LXL04_021705 · OH-1004

Cell membrane0.170

Rank 3 · LXL04_021705 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_021705 · OH-1004

Lysosome / Vacuole0.070

Rank 5 · LXL04_021705 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N216-268 aa

PF13839.13PC-Esterase269-570 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021705	`PF14416.12`	PMR5N	216	268	2.2e-21	76.7
LXL04_021705	`PF13839.13`	PC-Esterase	269	570	2.2e-77	261.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYS5`	Arabidopsis thaliana	Protein trichome birefringence-like 18	49.404%	Swiss-Prot	moderate database homology
`Q9FHM0`	Arabidopsis thaliana	Protein YLS7	63.544%	Swiss-Prot	moderate database homology
`O04523`	Arabidopsis thaliana	Xyloglucan O-acetyltransferase 1	39.394%	Swiss-Prot	moderate database homology
`O82509`	Arabidopsis thaliana	Protein trichome birefringence-like 23	38.567%	Swiss-Prot	moderate database homology
`Q8H1R3`	Arabidopsis thaliana	Protein trichome birefringence-like 24	36.438%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card