LXL04_021660 | RubberDandelionOmics

Gene overview

LXL04_021660

Reference: OH-1004 Chr: Chr04 Coordinates: 134393538-134394181 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · LXL04_021660|LXL04_021660|OH1004|cDNA

ATGCTTCCAGCAATGTCTATGGTGGAAGTAAGAGTTCCAAATTTGGACTGCCATGGCTGTGCTACCAAGCTCAAAAGAGCCCTCTTCAAGCTCAAAGGAGTGGAAGAGATAGAAATTGAAATGGAGATGCAGAAAATTGTTGTTAAAGGGTACGGATTGGAAGAAAGGAAGGTGTTGAAAGCGATTAAACGAGCGGGGAAAGCGGCGGAGCCATGGCCGTATCCGGGTTACTCCTCCCATTTCGCTTCTTTTTACAAATA...

CDS

Download CDS FASTA

429 bp · LXL04_021660|LXL04_021660|OH1004|CDS

ATGCTTCCAGCAATGTCTATGGTGGAAGTAAGAGTTCCAAATTTGGACTGCCATGGCTGTGCTACCAAGCTCAAAAGAGCCCTCTTCAAGCTCAAAGGAGTGGAAGAGATAGAAATTGAAATGGAGATGCAGAAAATTGTTGTTAAAGGGTACGGATTGGAAGAAAGGAAGGTGTTGAAAGCGATTAAACGAGCGGGGAAAGCGGCGGAGCCATGGCCGTATCCGGGTTACTCCTCCCATTTCGCTTCTTTTTACAAATA...

Protein

Download Protein FASTA

142 aa · LXL04_021660|LXL04_021660|OH1004|PROTEIN

MLPAMSMVEVRVPNLDCHGCATKLKRALFKLKGVEEIEIEMEMQKIVVKGYGLEERKVLKAIKRAGKAAEPWPYPGYSSHFASFYKYPTHIADQYYSGRNEAAGHNLHTFFHTPSVYSVAVASDEAVASLFSDDNPHACTIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021660`
TK1151 ID	TkA05G414440
OH-1004 ID	LXL04_021660
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.873 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021660

Location Chr04:134393538-134394181 (+)

Description Similar to HIPP31: Heavy metal-associated isoprenylated plant protein 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48970`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g56891`	Heavy-metal-binding protein.	No verified direct reference in this release
`At2g18196`	Heavy-metal-binding protein.	No verified direct reference in this release
`At4g08570`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g06330`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021660 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G18196

ath:AT3G48970

ath:AT3G56891

ath:AT4G08570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.456

Rank 1 · LXL04_021660 · OH-1004

Nucleus0.362

Rank 2 · LXL04_021660 · OH-1004

Cytoplasm0.342

Rank 3 · LXL04_021660 · OH-1004

Endoplasmic reticulum0.058

Rank 4 · LXL04_021660 · OH-1004

Plastid0.032

Rank 5 · LXL04_021660 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00403.33HMA10-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021660	`PF00403.33`	HMA	10	67	4.2e-12	47.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K70`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 31	67.376%	Swiss-Prot	strong database homology
`B3H6D0`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 45	38.994%	Swiss-Prot	moderate database homology
`F4IQG4`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 30	35.664%	Swiss-Prot	moderate database homology
`O81464`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 24	34.286%	Swiss-Prot	moderate database homology
`F4IC29`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 28	32.927%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card