LXL04_021659 | RubberDandelionOmics

Gene overview

LXL04_021659

Reference: OH-1004 Chr: Chr04 Coordinates: 134359824-134361125 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · LXL04_021659|LXL04_021659|OH1004|cDNA

AACTTCTCCAATTTTCAAGCATCTCTCTCCCCCatactttcttttctttctcctCATCCTCTTTCTTGCAATTTTGTTGTCGATCTTGATTATTCCATTACTGCAACAACCATGGCGAACGCAGCATCTGGCATGGCCGTGGATGACGAATGTAAATTGAAGTTTTTGGAGCTAAAAGCAAAGAGAAACTACCGATACATTGTTTTTAAGATCGAACAACAACAAGTGAATATCGAGAAACTCGGAGGCCCATCTGAGAG...

CDS

Download CDS FASTA

414 bp · LXL04_021659|LXL04_021659|OH1004|CDS

ATGGCGAACGCAGCATCTGGCATGGCCGTGGATGACGAATGTAAATTGAAGTTTTTGGAGCTAAAAGCAAAGAGAAACTACCGATACATTGTTTTTAAGATCGAACAACAACAAGTGAATATCGAGAAACTCGGAGGCCCATCTGAGAGCTACGAGGATTTCACAAACTCTCTCCCTCGCGACGAATGTCGCTATGCTGTCTTTGACTTTGACTTTATCACTGATGAGAATTGCCAGAAAAGCAAGATCTTCTTCATCGC...

Protein

Download Protein FASTA

137 aa · LXL04_021659|LXL04_021659|OH1004|PROTEIN

MANAASGMAVDDECKLKFLELKAKRNYRYIVFKIEQQQVNIEKLGGPSESYEDFTNSLPRDECRYAVFDFDFITDENCQKSKIFFIAWAPDTAKVRAKMVYASSKDRFKRELDGIQVELQATDPSEMSFDIVKSRAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021659`
TK1151 ID	TkA05G414380
OH-1004 ID	LXL04_021659
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 78.736 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021659

Location Chr04:134359824-134361125 (+)

Description Similar to ADF7: Actin-depolymerizing factor 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25590`	Actin-depolymerizing protein.	Arabidopsis actin-depolymerizing factor7 severs actin filaments and regulates actin cable turnover to promote normal pollen tube growth.2013 · DOI: 10.1105/tpc.113.117820
`At5g52360`	Actin-depolymerizing protein.	No verified direct reference in this release
`At1g01750`	Actin-depolymerizing protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0663800`	Actin-depolymerizing protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021659 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005884 actin filament Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0048046 apoplast Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G01750

ath:AT4G25590

ath:AT5G52360

dosa:Os02g0663800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.808

Rank 1 · LXL04_021659 · OH-1004

Nucleus0.285

Rank 2 · LXL04_021659 · OH-1004

Cell membrane0.093

Rank 3 · LXL04_021659 · OH-1004

Golgi apparatus0.043

Rank 4 · LXL04_021659 · OH-1004

Mitochondrion0.042

Rank 5 · LXL04_021659 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00241.26Cofilin_ADF7-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021659	`PF00241.26`	Cofilin_ADF	7	135	3.7e-41	140.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67ZM4`	Arabidopsis thaliana	Actin-depolymerizing factor 7	83.212%	Swiss-Prot	strong database homology
`Q8LFH6`	Arabidopsis thaliana	Actin-depolymerizing factor 12	80.292%	Swiss-Prot	strong database homology
`Q9LQ81`	Arabidopsis thaliana	Actin-depolymerizing factor 10	78.986%	Swiss-Prot	strong database homology
`Q6EUH7`	Oryza sativa subsp. japonica	Actin-depolymerizing factor 1	79.856%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card