LXL04_021546 | RubberDandelionOmics

Gene overview

LXL04_021546

Reference: OH-1004 Chr: Chr04 Coordinates: 132220089-132220933 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

346 bp · LXL04_021546|LXL04_021546|OH1004|cDNA

ATGGTGTCCGGGAAGAAGACGAAGAAGACTCATGAGAGCATCAACAATAGGTTAGCTCTCGTGATGAAGAGTGGAAAATACACGCTCGGTTACAAAACCGTGCTCGAGTCTCTCAGGAGCTCCAAAGGTAAGTTGATTATCATTTCCAACAATTGTCCGCCATTGAGGAAGTCCGAGATCGAGTATTACGCCATGCTCGCCAAAGTTGGGGTTCATCATTACAATGGAAACAATGTTGACCTAGGAACAGCATGTGGAAA...

CDS

Download CDS FASTA

339 bp · LXL04_021546|LXL04_021546|OH1004|CDS

ATGGTGTCCGGGAAGAAGACGAAGAAGACTCATGAGAGCATCAACAATAGGTTAGCTCTCGTGATGAAGAGTGGAAAATACACGCTCGGTTACAAAACCGTGCTCGAGTCTCTCAGGAGCTCCAAAGGTAAGTTGATTATCATTTCCAACAATTGTCCGCCATTGAGGAAGTCCGAGATCGAGTATTACGCCATGCTCGCCAAAGTTGGGGTTCATCATTACAATGGAAACAATGTTGACCTAGGAACAGCATGTGGAAA...

Protein

Download Protein FASTA

112 aa · LXL04_021546|LXL04_021546|OH1004|PROTEIN

MVSGKKTKKTHESINNRLALVMKSGKYTLGYKTVLESLRSSKGKLIIISNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLPGDN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021546`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021546

Location Chr04:132220089-132220933 (-)

Description Similar to RPL30: 60S ribosomal protein L30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g36240`	Large ribosomal subunit protein eL30z.	No verified direct reference in this release
`At1g77940`	Large ribosomal subunit protein eL30y.	No verified direct reference in this release
`At3g18740`	Large ribosomal subunit protein eL30x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021546 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

KEGG gene cross-reference

ath:AT1G36240

ath:AT1G77940

ath:AT3G18740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.822

Rank 1 · LXL04_021546 · OH-1004

Nucleus0.192

Rank 2 · LXL04_021546 · OH-1004

Cell membrane0.057

Rank 3 · LXL04_021546 · OH-1004

Mitochondrion0.046

Rank 4 · LXL04_021546 · OH-1004

Endoplasmic reticulum0.041

Rank 5 · LXL04_021546 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01248.32Ribosomal_L7Ae13-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021546	`PF01248.32`	Ribosomal_L7Ae	13	105	1.2e-24	86.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8F7`	Arabidopsis thaliana	Large ribosomal subunit protein eL30z	89.286%	Swiss-Prot	strong database homology
`Q8VZ19`	Arabidopsis thaliana	Large ribosomal subunit protein eL30y	88.393%	Swiss-Prot	strong database homology
`Q9LSA3`	Arabidopsis thaliana	Large ribosomal subunit protein eL30x	87.500%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card