LXL04_021533 | RubberDandelionOmics

Gene overview

LXL04_021533

Reference: OH-1004 Chr: Chr04 Coordinates: 131744812-131746422 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1113 bp · LXL04_021533|LXL04_021533|OH1004|cDNA

ATGGAACCGGGTGACCCTGGTCGAGGCTTTTACTACCACCAccaacaaccaccaccaccacagCGCCACCCTCTCCCTCACCACCAACTACCCCCTTCTCAACCTCCAGCAACCACCGCCAATGGGATCTTACAAAATCCCACCACCAATACACGATCCAGTCAAACGCTGTATCCTCACAACTCCGTCCCATCTGCCGTCTCTTCGCCGTTAGACACCGGCGTTCGGAGAAAAAGAGGAAGACCCAGAAAGTACAGCAC...

CDS

Download CDS FASTA

1113 bp · LXL04_021533|LXL04_021533|OH1004|CDS

ATGGAACCGGGTGACCCTGGTCGAGGCTTTTACTACCACCACCAACAACCACCACCACCACAGCGCCACCCTCTCCCTCACCACCAACTACCCCCTTCTCAACCTCCAGCAACCACCGCCAATGGGATCTTACAAAATCCCACCACCAATACACGATCCAGTCAAACGCTGTATCCTCACAACTCCGTCCCATCTGCCGTCTCTTCGCCGTTAGACACCGGCGTTCGGAGAAAAAGAGGAAGACCCAGAAAGTACAGCAC...

Protein

Download Protein FASTA

370 aa · LXL04_021533|LXL04_021533|OH1004|PROTEIN

MEPGDPGRGFYYHHQQPPPPQRHPLPHHQLPPSQPPATTANGILQNPTTNTRSSQTLYPHNSVPSAVSSPLDTGVRRKRGRPRKYSTPEQAAAAKKLASLSSPKNVTSQTIGGSSTTTPSTKKAFRGNSGQGFTPYMITVTAGEDINHKIMSFMQQSKQEICVISASGVISNATLHQPATSGGNITYEGRFDIISLCGSYIRADFESRSGGLSICLSSNDGQIIGGGVDGPLIAAGPVQVIVGTFVISGKSSGAVAKDDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021533`
TK1151 ID	TkA05G402370
OH-1004 ID	LXL04_021533
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.900
Protein coverage (%)	TK1151 97.059 / OH-1004 44.595 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021533

Location Chr04:131744812-131746422 (+)

Description Similar to AHL14: AT-hook motif nuclear-localized protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04590`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At2g45850`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At2g33620`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g12080`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	Identification of a novel plant MAR DNA binding protein localized on chromosomal surfaces.2004 · DOI: 10.1007/s11103-004-3249-5
`At4g25320`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	Cell-to-cell movement of two interacting AT-hook factors in Arabidopsis root vascular tissue patterning.2013 · DOI: 10.1105/tpc.112.102210

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021533 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010089 xylem development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0098687 chromosomal region Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003680 minor groove of adenine-thymine-rich DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G33620

ath:AT2G45850

ath:AT3G04590

ath:AT4G12080

ath:AT4G25320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · LXL04_021533 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_021533 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_021533 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_021533 · OH-1004

Plastid0.014

Rank 5 · LXL04_021533 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479.22PCC128-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021533	`PF03479.22`	PCC	128	245	6.8e-31	107.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A1L4X7`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 14	45.625%	Swiss-Prot	moderate database homology
`O80834`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 9	46.486%	Swiss-Prot	weak database homology
`O22812`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 10	43.386%	Swiss-Prot	weak database homology
`Q8VYJ2`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 1	42.500%	Swiss-Prot	weak database homology
`Q9SB31`	Arabidopsis thaliana	AT-hook motif nuclear-localized protein 3	39.301%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card