Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1137 bp · LXL04_021523|LXL04_021523|OH1004|cDNA
ATGAAGATCGTTCGGAGAGATTTTGTTCCCAATGGCCCTGGCAGCGTCAAGATGATTCCCGATGAATCAGACGATTTGTGGCTCGCTTATAACTTAATTGCGCCCGGTGATACTGTCATGGCTGTTACAATCAGAAAAGTTCTTAGAGAAGCAGCTTCAGGATCAAGAGAAGCAGAACGTGTGAAACTAAAACTTGAAATCAAAGTTGAGAATGTTGATTATGACAAGGAAGGTTCCATGTTGAGAATACGTGGGAAGAA...
1137 bp · LXL04_021523|LXL04_021523|OH1004|CDS
ATGAAGATCGTTCGGAGAGATTTTGTTCCCAATGGCCCTGGCAGCGTCAAGATGATTCCCGATGAATCAGACGATTTGTGGCTCGCTTATAACTTAATTGCGCCCGGTGATACTGTCATGGCTGTTACAATCAGAAAAGTTCTTAGAGAAGCAGCTTCAGGATCAAGAGAAGCAGAACGTGTGAAACTAAAACTTGAAATCAAAGTTGAGAATGTTGATTATGACAAGGAAGGTTCCATGTTGAGAATACGTGGGAAGAA...
Protein
Download Protein FASTA378 aa · LXL04_021523|LXL04_021523|OH1004|PROTEIN
MKIVRRDFVPNGPGSVKMIPDESDDLWLAYNLIAPGDTVMAVTIRKVLREAASGSREAERVKLKLEIKVENVDYDKEGSMLRIRGKNILENEHVKIGQFHTLEIELHRPFVVRKVLWDSLTIDALQQAADPSASADLAVVLMQEGLSHILLVGKSVTITRSRIEASIPRKHGPSIAGYDKALNKFYENVLQAFVKHIDFKVVRCAVIASPGFTKDQFHRHLMLEAERRNLRDIIENKSRIILVHSTSGYKHSLREVLDAP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021523 |
|---|---|
| TK1151 ID | TkA05G401610 |
| OH-1004 ID | LXL04_021523 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021523 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:131578143-131581302 (+) | |||||||||
| Description | Similar to PEL1: Protein PELOTA 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000212 meiotic spindle organization Biological Process GO:0006417 regulation of translation Biological Process GO:0007291 sperm individualization Biological Process GO:0016441 post-transcriptional gene silencing Biological Process GO:0019827 stem cell population maintenance Biological Process GO:0030718 germ-line stem cell population maintenance Biological Process GO:0032790 ribosome disassembly Biological Process GO:0036098 male germ-line stem cell population maintenance Biological Process GO:0048137 spermatocyte division Biological Process GO:0051078 meiotic nuclear membrane disassembly Biological Process GO:0051276 chromosome organization Biological Process GO:0051301 cell division Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G58390 ath:AT4G27650 bta:528728 dme:Dmel_CG3959 rno:294754 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26356.1Pelota_N1-128 aaPF03464.21eRF1_2137-268 aaPF03465.21eRF1_3272-370 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021523 | PF26356.1 | Pelota_N | 1 | 128 | 7.5e-45 | 152.7 |
| LXL04_021523 | PF03464.21 | eRF1_2 | 137 | 268 | 3.9e-28 | 99.1 |
| LXL04_021523 | PF03465.21 | eRF1_3 | 272 | 370 | 2.7e-28 | 99.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.