LXL04_021513 | RubberDandelionOmics

Gene overview

LXL04_021513

Reference: OH-1004 Chr: Chr04 Coordinates: 131488150-131491165 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_021513|LXL04_021513|OH1004|cDNA

aTGTTAGGAGCTAATTTCTTGCAGTTATGCTTCATTACTAAAATGGTGTTGACATACAAAAGGAAGCGGCTCTCTTCAAGACCTGATCTAGGGTTTGAAAATGAATGCCCTGATCAATCTCCAGGATCCCAAACTTTACAAGTTTTAAAAAAACCAGTAACAGAAGAacatgaagaagaagaagaagaagattcaAAACATGAATCTGAGAGAAAAGATCCAGAGGTAATAACAAACATGGATAGCAACCCAAACATTGT...

CDS

Download CDS FASTA

1743 bp · LXL04_021513|LXL04_021513|OH1004|CDS

ATGTTAGGAGCTAATTTCTTGCAGTTATGCTTCATTACTAAAATGGTGTTGACATACAAAAGGAAGCGGCTCTCTTCAAGACCTGATCTAGGGTTTGAAAATGAATGCCCTGATCAATCTCCAGGATCCCAAACTTTACAAGTTTTAAAAAAACCAGTAACAGAAGAACATGAAGAAGAAGAAGAAGAAGATTCAAAACATGAATCTGAGAGAAAAGATCCAGAGGTAATAACAAACATGGATAGCAACCCAAACATTGT...

Protein

Download Protein FASTA

580 aa · LXL04_021513|LXL04_021513|OH1004|PROTEIN

MLGANFLQLCFITKMVLTYKRKRLSSRPDLGFENECPDQSPGSQTLQVLKKPVTEEHEEEEEEDSKHESERKDPEVITNMDSNPNIVSECNLLSVSGQTNHESSLEPVELSSKGKSGNSCEDRVKDNKPGLPLITFSRRFRHKKAVDRSKDDLTVTNESNSIMDNSSLVDHSSQEKKTSEADVPKIKMYVSVNLNIPDFSNERLNTEECILKDTLPITGPTSDKQVEASEGLVTAVNEESRMVSSESDGITITINKKKDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021513`
TK1151 ID	TkA05G401210
OH-1004 ID	LXL04_021513
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.586 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021513

Location Chr04:131488150-131491165 (-)

Description Similar to CHR4: Protein CHROMATIN REMODELING 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44800`	Chromatin-remodeling protein that binds DNA through histones and regulates gene transcription.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021513 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0042735 endosperm protein body Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0004386 helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042393 histone binding Molecular Function

KEGG gene cross-reference

ath:AT5G44800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · LXL04_021513 · OH-1004

Cytoplasm0.114

Rank 2 · LXL04_021513 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_021513 · OH-1004

Mitochondrion0.011

Rank 4 · LXL04_021513 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_021513 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KBP5`	Arabidopsis thaliana	Protein CHROMATIN REMODELING 4	65.385%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card