LXL04_021484 | RubberDandelionOmics

Gene overview

LXL04_021484

Reference: OH-1004 Chr: Chr04 Coordinates: 131080015-131082622 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1563 bp · LXL04_021484|LXL04_021484|OH1004|cDNA

ATGCTGAATGGTAATCGAAGTGATGGAGATGGGGAAAGTGTCTTTAAAAGTGCATTCAAAGTTATGGTTGTCGATCATAACAAGGGCTTGCTCAATAATGTGACTGAATTTCTTAAGTTACATTCATTTGAAGTTACATTGGTCGAAGATGGTGGTGCTGCTTTAAGGATACTCTTAGTAAAGAAGGACAAATTTGATCTCATACTAATAGATAGTGACTTGAGAGATGTGGATGTTAGCACATTCCTCCGATTAACAAA...

CDS

Download CDS FASTA

1563 bp · LXL04_021484|LXL04_021484|OH1004|CDS

ATGCTGAATGGTAATCGAAGTGATGGAGATGGGGAAAGTGTCTTTAAAAGTGCATTCAAAGTTATGGTTGTCGATCATAACAAGGGCTTGCTCAATAATGTGACTGAATTTCTTAAGTTACATTCATTTGAAGTTACATTGGTCGAAGATGGTGGTGCTGCTTTAAGGATACTCTTAGTAAAGAAGGACAAATTTGATCTCATACTAATAGATAGTGACTTGAGAGATGTGGATGTTAGCACATTCCTCCGATTAACAAA...

Protein

Download Protein FASTA

520 aa · LXL04_021484|LXL04_021484|OH1004|PROTEIN

MLNGNRSDGDGESVFKSAFKVMVVDHNKGLLNNVTEFLKLHSFEVTLVEDGGAALRILLVKKDKFDLILIDSDLRDVDVSTFLRLTKDMHILSMVMRDQEVDDKFLLKMIKNGAFLVIKRPLTNEVVFQARQHVIRERLHKLEKFKMSNGSGSIKPESASLGDKRKDKCNARKNVKNCYNTGSSNVIQLDDDDDDDDDDESCNAKKKICLEWTEELHDKFLRVVNKLGEENCIPRAIVNAMGVPGLKRRQVANHLQKCLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021484`
TK1151 ID	TkA05G399220
OH-1004 ID	LXL04_021484
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.200
Protein coverage (%)	TK1151 91.842 / OH-1004 69.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021484

Location Chr04:131080015-131082622 (+)

Description Similar to ARR10: Two-component response regulator ARR10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31920`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500
`At2g25180`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The rate of cell differentiation controls the Arabidopsis root meristem growth phase.2010 · DOI: 10.1016/j.cub.2010.05.035
`At3g16857`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 ARR1, a transcription factor for genes immediately responsive to cytokinins.2001 · DOI: 10.1126/science.1065201 A genetic framework for the control of cell division and differentiation in the root meristem.2008 · DOI: 10.1126/science.1164147
`At4g16110`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis.2001 · DOI: 10.1007/s004380000400 Two-component circuitry in Arabidopsis cytokinin signal transduction.2001 · DOI: 10.1038/35096500 The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis.2004 · DOI: 10.1038/sj.emboj.7600337 Cytokinin-mediated control of leaf longevity by AHK3 through phosphorylation of ARR2 in Arabidopsis.2006 · DOI: 10.1073/pnas.0505150103

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X1N2`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021484 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

KEGG gene cross-reference

ath:AT2G25180

ath:AT3G16857

ath:AT4G16110

ath:AT4G31920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · LXL04_021484 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_021484 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_021484 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_021484 · OH-1004

Plastid0.010

Rank 5 · LXL04_021484 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072.31Response_reg21-128 aa

PF00249.38Myb_DNA-binding211-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021484	`PF00072.31`	Response_reg	21	128	4.1e-07	30.9
LXL04_021484	`PF00249.38`	Myb_DNA-binding	211	259	7.4e-07	29.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49397`	Arabidopsis thaliana	Two-component response regulator ARR10	32.099%	Swiss-Prot	weak database homology
`P62598`	Arabidopsis thaliana	Two-component response regulator ARR12	33.333%	Swiss-Prot	weak database homology
`Q940D0`	Arabidopsis thaliana	Two-component response regulator ARR1	28.464%	Swiss-Prot	weak database homology
`Q9ZWJ9`	Arabidopsis thaliana	Two-component response regulator ARR2	28.295%	Swiss-Prot	weak database homology
`A2X1N2`	Oryza sativa subsp. indica	Two-component response regulator ORR24	28.514%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card