LXL04_021413 | RubberDandelionOmics

Gene overview

LXL04_021413

Reference: OH-1004 Chr: Chr04 Coordinates: 129230031-129231669 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · LXL04_021413|LXL04_021413|OH1004|cDNA

ATGCAGACGAAGAATGATATGATCTTCCACGAATCTGATCTTGCTGTCTTAATCTGGGTGAGTGGTGGCCGGCTgtttggtggtgGGGAAAGGGGTGATTCCAACTGCTGCAACGGTTGGGTGCTCAAAGATGGAGTTGGGTATCTGAGCAATCCGGTTCATAAAAAAGTACCGGTGCTTGTTCATAGCGGAAATCCGATCACAGAGTCTCTTGTGATTGTGGAATACATCGATGATGCGTGGAAAGTGTTTCCGATTTT...

CDS

Download CDS FASTA

492 bp · LXL04_021413|LXL04_021413|OH1004|CDS

ATGCAGACGAAGAATGATATGATCTTCCACGAATCTGATCTTGCTGTCTTAATCTGGGTGAGTGGTGGCCGGCTGTTTGGTGGTGGGGAAAGGGGTGATTCCAACTGCTGCAACGGTTGGGTGCTCAAAGATGGAGTTGGGTATCTGAGCAATCCGGTTCATAAAAAAGTACCGGTGCTTGTTCATAGCGGAAATCCGATCACAGAGTCTCTTGTGATTGTGGAATACATCGATGATGCGTGGAAAGTGTTTCCGATTTT...

Protein

Download Protein FASTA

163 aa · LXL04_021413|LXL04_021413|OH1004|PROTEIN

MQTKNDMIFHESDLAVLIWVSGGRLFGGGERGDSNCCNGWVLKDGVGYLSNPVHKKVPVLVHSGNPITESLVIVEYIDDAWKVFPILPQDPYEKAIDRFWAKFINDKSSSLTLSINQDAYYIKVDVDCLWAHSLTVHDYQGDKSTTEKSKSRPKFQSKNQAQK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021413`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021413

Location Chr04:129230031-129231669 (+)

Description Similar to HSP26-A: Probable glutathione S-transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29420`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At3g09270`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At2g29490`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021413 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009408 response to heat Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010038 response to metal ion Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G29420

ath:AT2G29490

ath:AT3G09270

gmx:100527851

nta:107802704

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · LXL04_021413 · OH-1004

Nucleus0.234

Rank 2 · LXL04_021413 · OH-1004

Mitochondrion0.119

Rank 3 · LXL04_021413 · OH-1004

Peroxisome0.084

Rank 4 · LXL04_021413 · OH-1004

Endoplasmic reticulum0.072

Rank 5 · LXL04_021413 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798.27GST_N50-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021413	`PF02798.27`	GST_N	50	78	5.9e-08	33.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZW24`	Arabidopsis thaliana	Glutathione S-transferase U7	64.912%	Swiss-Prot	weak database homology
`Q9SR36`	Arabidopsis thaliana	Glutathione S-transferase U8	67.241%	Swiss-Prot	weak database homology
`Q9ZW30`	Arabidopsis thaliana	Glutathione S-transferase U1	65.574%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card