Gene Card
Gene overview
cDNA / CDS / Protein Sequences
588 bp · LXL04_021387|LXL04_021387|OH1004|cDNA
ATGGGAAGAAAGCTTGATGCTCTACTTGGCCGGAAATTCAAACACTCCAAACTTAAAACCACCCTAAACCTCGCCATCTCCCGCCTCTCACTCCTTAAAAACAACCGTCTTGCAAGATTCGCCATAGCCCGCTCTGATGTCATCCAACTCCTCCGCCTTAACCACCACCCACAAGCTCTTCTTCGGGTTGAGCAAGTGATCAAGGACCAAAACATGTTAGATGTGTATGATATGATACATGGCTATTGCCATCTACTTAT...
588 bp · LXL04_021387|LXL04_021387|OH1004|CDS
ATGGGAAGAAAGCTTGATGCTCTACTTGGCCGGAAATTCAAACACTCCAAACTTAAAACCACCCTAAACCTCGCCATCTCCCGCCTCTCACTCCTTAAAAACAACCGTCTTGCAAGATTCGCCATAGCCCGCTCTGATGTCATCCAACTCCTCCGCCTTAACCACCACCCACAAGCTCTTCTTCGGGTTGAGCAAGTGATCAAGGACCAAAACATGTTAGATGTGTATGATATGATACATGGCTATTGCCATCTACTTAT...
Protein
Download Protein FASTA195 aa · LXL04_021387|LXL04_021387|OH1004|PROTEIN
MGRKLDALLGRKFKHSKLKTTLNLAISRLSLLKNNRLARFAIARSDVIQLLRLNHHPQALLRVEQVIKDQNMLDVYDMIHGYCHLLIQRINLIEQVNDCPGELEEAISNLLYAAPRCGEFPELQEIRLILTKRLGKEFASGAIDLQTNCGVTQNMIQKLSPTQSTLEYRMNKLMGIGNENGIVLKLQEIKEVTNV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021387 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021387 |
|---|---|
| Location | Chr04:128600449-128601337 (+) |
| Description | Similar to DDB_G0289029: IST1-like protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0008104 intracellular protein localization Biological Process GO:0015031 protein transport Biological Process GO:0036258 multivesicular body assembly Biological Process GO:0045184 establishment of protein localization Biological Process GO:0045862 positive regulation of proteolysis Biological Process GO:0051301 cell division Biological Process GO:0061640 cytoskeleton-dependent cytokinesis Biological Process GO:0061952 midbody abscission Biological Process GO:1904903 ESCRT III complex disassembly Biological Process GO:0000785 chromatin Cellular Component GO:0005576 extracellular region Cellular Component GO:0005635 nuclear envelope Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0289029 hsa:9798 mmu:71955 pon:100173540 rno:307833 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03398.20Ist119-182 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021387 | PF03398.20 | Ist1 | 19 | 182 | 3e-49 | 167.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.