LXL04_021386 | RubberDandelionOmics

Gene overview

LXL04_021386

Reference: OH-1004 Chr: Chr04 Coordinates: 128590535-128595846 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1900 bp · LXL04_021386|LXL04_021386|OH1004|cDNA

ATGGGGTTAGTTGAGGGAGTAGACCAACGAACTGGGATGACATGGCCAATGTTTGGGCGATGTTTACAGTGCTCCCCGTTGCTCATATCCTCGTCTTCTCCGCCTCACTCTCTTTCCATTCCTATATCTCTCTCATTTCTCCCCCAAATCCACCATCTACCTATCTCTCTCTATCTCTGCAATGTCTTCTTCACTTCTGCAATCTAGGGCTCCCCCAGCTCTATCCTTCTCTTCCTCCATCTCCGCAGCCAATACTCACT...

CDS

Download CDS FASTA

1563 bp · LXL04_021386|LXL04_021386|OH1004|CDS

TTGGGCGATGTTTACAGTGCTCCCCGTTGCTCATATCCTCGTCTTCTCCGCCTCACTCTCTTTCCATTCCTATATCTCTCTCATTTCTCCCCCAAATCCACCATCTACCTATCTCTCTCTATCTCTGCAATGTCTTCTTCACTTCTGCAATCTAGGGCTCCCCCAGCTCTATCCTTCTCTTCCTCCATCTCCGCAGCCAATACTCACTGGCGCTTTACATCCTCCCCCGCCGTTACATTCACTCGCCGCACAAAGAATTT...

Protein

Download Protein FASTA

520 aa · LXL04_021386|LXL04_021386|OH1004|PROTEIN

MGDVYSAPRCSYPRLLRLTLFPFLYLSHFSPKSTIYLSLSISAMSSSLLQSRAPPALSFSSSISAANTHWRFTSSPAVTFTRRTKNFTVHAKIREIFMPALSSTMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGESAPVGAPIGLLAETEAEIEEAKAKAASAGSSVPPTPAASAPSPPPPPAPVAAAPTPAAAPVAADGPRKIVSTPFAKKLAKQHKVDINKVVGTGPFGRITPADVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021386`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021386

Location Chr04:128590535-128595846 (+)

Description Similar to LTA2: Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25860`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release
`At1g34430`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021386 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0006096 glycolytic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0004742 dihydrolipoyllysine-residue acetyltransferase activity Molecular Function

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT1G34430

ath:AT3G25860

rbe:RBE_0300

rco:RC0764

rfe:RF_0761

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · LXL04_021386 · OH-1004

Mitochondrion0.054

Rank 2 · LXL04_021386 · OH-1004

Cytoplasm0.028

Rank 3 · LXL04_021386 · OH-1004

Peroxisome0.018

Rank 4 · LXL04_021386 · OH-1004

Nucleus0.014

Rank 5 · LXL04_021386 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00364.29Biotin_lipoyl95-165 aa

PF02817.23E3_binding226-260 aa

PF00198.292-oxoacid_dh300-519 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021386	`PF00364.29`	Biotin_lipoyl	95	165	2.4e-15	56.8
LXL04_021386	`PF02817.23`	E3_binding	226	260	6.5e-13	49.4
LXL04_021386	`PF00198.29`	2-oxoacid_dh	300	519	1e-62	212.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQI8`	Arabidopsis thaliana	Dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic	75.484%	Swiss-Prot	strong database homology
`Q9C8P0`	Arabidopsis thaliana	Dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic	60.041%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card