LXL04_021337 | RubberDandelionOmics

Gene overview

LXL04_021337

Reference: OH-1004 Chr: Chr04 Coordinates: 127542913-127543452 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · LXL04_021337|LXL04_021337|OH1004|cDNA

ATGAATGTTGCTGGTGGTAATAGAGGCGGAGAAGACACCGATCTCAAATTCTCATCGCTCTCTCTATGGACCTTCACTGTCTTCTGTCGATACCAGCACCTTCTTGAGTTAAATTTAGCCGGAGTTCTTTTGTTGTTCTTCCTCGTTGCCACGGTTGAAATCGATGTCACTACTGGAGTAATGTTCAATATCTGTCCAAGAAACATCGAAATCGATGTCGATACCAGCACCTTCCTCGTTACCTCGTTGGAGAAGAAGAA...

CDS

Download CDS FASTA

540 bp · LXL04_021337|LXL04_021337|OH1004|CDS

ATGAATGTTGCTGGTGGTAATAGAGGCGGAGAAGACACCGATCTCAAATTCTCATCGCTCTCTCTATGGACCTTCACTGTCTTCTGTCGATACCAGCACCTTCTTGAGTTAAATTTAGCCGGAGTTCTTTTGTTGTTCTTCCTCGTTGCCACGGTTGAAATCGATGTCACTACTGGAGTAATGTTCAATATCTGTCCAAGAAACATCGAAATCGATGTCGATACCAGCACCTTCCTCGTTACCTCGTTGGAGAAGAAGAA...

Protein

Download Protein FASTA

179 aa · LXL04_021337|LXL04_021337|OH1004|PROTEIN

MNVAGGNRGGEDTDLKFSSLSLWTFTVFCRYQHLLELNLAGVLLLFFLVATVEIDVTTGVMFNICPRNIEIDVDTSTFLVTSLEKKNQLPPRNIDLYPNLSKDRIVIVLYIHNLPQYLKLVIDSLSHVSGINETLLIVSHDGYFEEMNKIIGIKFCQVKQVFTFFYHTIAKKNQQIFPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021337`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021337

Location Chr04:127542913-127543452 (-)

Description Similar to GNT2: Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05320`	Catalyzes an essential step in the conversion of oligo-mannose and hybrid to complex N-glycans.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021337 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009312 oligosaccharide biosynthetic process Biological Process

GO:0019082 viral protein processing Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0015934 large ribosomal subunit Cellular Component

GO:0016020 membrane Cellular Component

GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane Cellular Component

GO:0008455 alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity Molecular Function

GO:0030145 manganese ion binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT2G05320

hsa:4247

mmu:217664

rno:94273

ssc:100151745

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.483

Rank 1 · LXL04_021337 · OH-1004

Golgi apparatus0.189

Rank 2 · LXL04_021337 · OH-1004

Nucleus0.169

Rank 3 · LXL04_021337 · OH-1004

Cytoplasm0.151

Rank 4 · LXL04_021337 · OH-1004

Cell membrane0.084

Rank 5 · LXL04_021337 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05060.21MGAT289-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021337	`PF05060.21`	MGAT2	89	166	1.6e-19	71.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT88`	Arabidopsis thaliana	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase	64.634%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card