LXL04_021311 | RubberDandelionOmics

Gene overview

LXL04_021311

Reference: OH-1004 Chr: Chr04 Coordinates: 127032242-127037617 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3702 bp · LXL04_021311|LXL04_021311|OH1004|cDNA

ATGCTACACACCAAAAGTGATTTGGTACAAAACCAAGCCCTATCTAACAATCCACCGTCTATCAGCAccccgaccaccaccaccagtcAACCACCACACCATCCTCACCGTTACCGTCACCGCCGCGACCTTCTACTGATCACATACAGGCGCGCCCTTGATAAAACCTCATATCCACAAACGTTTACGGTGATGAAGGACATACCACGTCCGTCTTCGTATGGCTCCGTGTACGTGCCTCCGCACCATCGCCTCGGCAC...

CDS

Download CDS FASTA

3702 bp · LXL04_021311|LXL04_021311|OH1004|CDS

ATGCTACACACCAAAAGTGATTTGGTACAAAACCAAGCCCTATCTAACAATCCACCGTCTATCAGCACCCCGACCACCACCACCAGTCAACCACCACACCATCCTCACCGTTACCGTCACCGCCGCGACCTTCTACTGATCACATACAGGCGCGCCCTTGATAAAACCTCATATCCACAAACGTTTACGGTGATGAAGGACATACCACGTCCGTCTTCGTATGGCTCCGTGTACGTGCCTCCGCACCATCGCCTCGGCAC...

Protein

Download Protein FASTA

1233 aa · LXL04_021311|LXL04_021311|OH1004|PROTEIN

MLHTKSDLVQNQALSNNPPSISTPTTTTSQPPHHPHRYRHRRDLLLITYRRALDKTSYPQTFTVMKDIPRPSSYGSVYVPPHHRLGTVVTAAPSPSPNISSTPHAVLDNTNSFVSSSQSNNANRFTVPYPYLPPPQISKSHIDNVLQEGPHGQFVFPIQPGVSTSDIDSWKWRLTTLLNSKDKQELISREKKDRRDYEQISALASSMGLHSQMYAKVLVISKVPLPNYRFDLDDKRPQREVALPEGLQNRVDAHLKEYLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021311`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021311

Location Chr04:127032242-127037617 (-)

Description Similar to At2g01130: DExH-box ATP-dependent RNA helicase DExH5, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01130`	DExH-box ATP-dependent RNA helicase DExH5, mitochondrial.	No verified direct reference in this release
`At1g48650`	DExH-box ATP-dependent RNA helicase DExH3.	No verified direct reference in this release
`At2g35920`	DExH-box ATP-dependent RNA helicase DExH1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021311 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001503 ossification Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006359 regulation of transcription by RNA polymerase III Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009615 response to virus Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031442 positive regulation of mRNA 3'-end processing Biological Process

GO:0032206 positive regulation of telomere maintenance Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0034644 cellular response to UV Biological Process

KEGG gene cross-reference

ath:AT1G48650

ath:AT2G01130

ath:AT2G35920

bta:509583

mmu:72162

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.571

Rank 1 · LXL04_021311 · OH-1004

Nucleus0.418

Rank 2 · LXL04_021311 · OH-1004

Mitochondrion0.065

Rank 3 · LXL04_021311 · OH-1004

Cell membrane0.048

Rank 4 · LXL04_021311 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_021311 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27261.1DEXH1_3_5_N168-239 aa

PF00270.36DEAD339-493 aa

PF00271.38Helicase_C602-728 aa

PF04408.30WHD_HA2792-820 aa

PF21010.3HA2_C821-880 aa

PF07717.23OB_NTP_bind947-1029 aa

PF26026.1RNA_hel_CTD1037-1093 aa

PF00035.33dsrm1155-1216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021311	`PF27261.1`	DEXH1_3_5_N	168	239	4.7e-35	120.3
LXL04_021311	`PF00270.36`	DEAD	339	493	1.5e-11	45.0
LXL04_021311	`PF00271.38`	Helicase_C	602	728	1.6e-12	48.4
LXL04_021311	`PF04408.30`	WHD_HA2	792	820	9e-08	32.7
LXL04_021311	`PF21010.3`	HA2_C	821	880	2.8e-15	57.3
LXL04_021311	`PF07717.23`	OB_NTP_bind	947	1029	4.3e-18	66.0
LXL04_021311	`PF26026.1`	RNA_hel_CTD	1037	1093	2.7e-21	75.8
LXL04_021311	`PF00035.33`	dsrm	1155	1216	3e-09	38.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IM84`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH5, mitochondrial	65.128%	Swiss-Prot	strong database homology
`F4HYJ7`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH3	64.646%	Swiss-Prot	strong database homology
`F4ILR7`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH1	46.357%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card