LXL04_021294 | RubberDandelionOmics

Gene overview

LXL04_021294

Reference: OH-1004 Chr: Chr04 Coordinates: 126797160-126797783 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_021294|LXL04_021294|OH1004|cDNA

ATGAAGCAAACACTCCCTTGTGTTCTCCTACTTCTCTTCATCATCGCTACAACCTCACTATTTTCTTCTACCACCGCCGACCAAGATGTAAAAGACTCTACCGGAAATAAGGTCTTGGATAACGTTCCATACCGCATTGGCCCAGTCACCAAGGGTGGCCAAATCAAGTTAACTGACACCATAgccaaaaagaaagtttgtCCATTCAACCCGGTGCAAGATCCAGCTCAGAATGCCATAGGCAGCCAATTCAGGTTCAC...

CDS

Download CDS FASTA

624 bp · LXL04_021294|LXL04_021294|OH1004|CDS

ATGAAGCAAACACTCCCTTGTGTTCTCCTACTTCTCTTCATCATCGCTACAACCTCACTATTTTCTTCTACCACCGCCGACCAAGATGTAAAAGACTCTACCGGAAATAAGGTCTTGGATAACGTTCCATACCGCATTGGCCCAGTCACCAAGGGTGGCCAAATCAAGTTAACTGACACCATAGCCAAAAAGAAAGTTTGTCCATTCAACCCGGTGCAAGATCCAGCTCAGAATGCCATAGGCAGCCAATTCAGGTTCAC...

Protein

Download Protein FASTA

207 aa · LXL04_021294|LXL04_021294|OH1004|PROTEIN

MKQTLPCVLLLLFIIATTSLFSSTTADQDVKDSTGNKVLDNVPYRIGPVTKGGQIKLTDTIAKKKVCPFNPVQDPAQNAIGSQFRFTMPRKTKYLRTSSVIGIDSGSSKLDQCNESTFWTVPDAEAKPPSNLITTGGGFDQAITCFQIVGYPKPTNPKVHSYMLQHCPSFCGAGPSTCFNISIHMDNGVRRFSTTGGTPFEFVFYKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021294`
TK1151 ID	TkA05G378120
OH-1004 ID	LXL04_021294
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	70.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021294

Location Chr04:126797160-126797783 (-)

Description Similar to Chymotrypsin inhibitor 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17860`	Can inhibit both serine proteases and cysteine proteases.	Arabidopsis Kunitz Trypsin Inhibitors in Defense Against Spider Mites.2018 · DOI: 10.3389/fpls.2018.00986

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021294 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009625 response to insect Biological Process

GO:0010466 negative regulation of peptidase activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004867 serine-type endopeptidase inhibitor activity Molecular Function

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

GO:0030414 peptidase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G17860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.502

Rank 1 · LXL04_021294 · OH-1004

Endoplasmic reticulum0.200

Rank 2 · LXL04_021294 · OH-1004

Cytoplasm0.165

Rank 3 · LXL04_021294 · OH-1004

Lysosome / Vacuole0.100

Rank 4 · LXL04_021294 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_021294 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00197.25Kunitz_legume30-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021294	`PF00197.25`	Kunitz_legume	30	206	2.9e-23	83.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMU2`	Arabidopsis thaliana	Kunitz trypsin inhibitor 5	22.115%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card