LXL04_021290 | RubberDandelionOmics

Gene overview

LXL04_021290

Reference: OH-1004 Chr: Chr04 Coordinates: 126699070-126702693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_021290|LXL04_021290|OH1004|cDNA

ATGACATTACTCCCAACTGCATCGCAAATCGATGGGAATCACCCTTCTGGACTCGATTGGACTACCGAGGTCTGCCACTCCTCTATCAAATTCACTTCTGAAGGAACACAAGTCATGCAAATTGGGAAAGAGATACCAATTAGCTTTGGTAACAAAGGAAATGAGGTACAAATGCACGAAGTTATGAGCTGGTTACTGGAGCCTTTAAGCAATGAGCGTAAGGAGATAGAAAAACTTGTCATAAAGAATGGAGGCAAATA...

CDS

Download CDS FASTA

912 bp · LXL04_021290|LXL04_021290|OH1004|CDS

ATGACATTACTCCCAACTGCATCGCAAATCGATGGGAATCACCCTTCTGGACTCGATTGGACTACCGAGGTCTGCCACTCCTCTATCAAATTCACTTCTGAAGGAACACAAGTCATGCAAATTGGGAAAGAGATACCAATTAGCTTTGGTAACAAAGGAAATGAGGTACAAATGCACGAAGTTATGAGCTGGTTACTGGAGCCTTTAAGCAATGAGCGTAAGGAGATAGAAAAACTTGTCATAAAGAATGGAGGCAAATA...

Protein

Download Protein FASTA

303 aa · LXL04_021290|LXL04_021290|OH1004|PROTEIN

MTLLPTASQIDGNHPSGLDWTTEVCHSSIKFTSEGTQVMQIGKEIPISFGNKGNEVQMHEVMSWLLEPLSNERKEIEKLVIKNGGKYSAELTKRTTLDYSNFQVYLLLFPGILPEKRARSYLFGNSPHIPGLAFPVQELFLEDVLEKTRSVYKSYNPNTRQSLEDWSRSDAYMGLVEATIEYICRHEGPGAILVFLTGWDKISKLLDNVKANNFLNNPSKFLVPPLHGSMPTINQREIFDCPPSGTRKVVLATSIAESSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021290`
TK1151 ID	TkA05G377820
OH-1004 ID	LXL04_021290
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021290

Location Chr04:126699070-126702693 (-)

Description Similar to At2g35920: DExH-box ATP-dependent RNA helicase DExH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35920`	DExH-box ATP-dependent RNA helicase DExH1.	No verified direct reference in this release
`At1g48650`	DExH-box ATP-dependent RNA helicase DExH3.	No verified direct reference in this release
`At2g01130`	DExH-box ATP-dependent RNA helicase DExH5, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021290 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001503 ossification Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006359 regulation of transcription by RNA polymerase III Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009615 response to virus Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031442 positive regulation of mRNA 3'-end processing Biological Process

GO:0032206 positive regulation of telomere maintenance Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0034644 cellular response to UV Biological Process

KEGG gene cross-reference

ath:AT1G48650

ath:AT2G01130

ath:AT2G35920

hsa:170506

mmu:72162

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · LXL04_021290 · OH-1004

Nucleus0.385

Rank 2 · LXL04_021290 · OH-1004

Mitochondrion0.134

Rank 3 · LXL04_021290 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_021290 · OH-1004

Cell membrane0.070

Rank 5 · LXL04_021290 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00271.38Helicase_C178-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021290	`PF00271.38`	Helicase_C	178	266	3.5e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4ILR7`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH1	60.360%	Swiss-Prot	moderate database homology
`F4HYJ7`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH3	42.128%	Swiss-Prot	moderate database homology
`F4IM84`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH5, mitochondrial	39.419%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card