LXL04_021283 | RubberDandelionOmics

Gene overview

LXL04_021283

Reference: OH-1004 Chr: Chr04 Coordinates: 126534919-126536288 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_021283|LXL04_021283|OH1004|cDNA

ATGGGTGATCATTTCGTCTTTCTGGTTGATCGGTTGCTCACCGAATCCACTTTAGAGGCTGCAATCGAAAGCAGAAACCCTTCATATCCTTTATCCCCCGCCATCGACACCATGATTGATTGTTCTTCTCATATGGATCCTCAAACTCCTTTCACCCCAAGGAAAATGGTGGAATGCAGAATATGCCAGGATGAGGATTTTGATTCGACTATGGAGACTCCTTGCTCTTGTTGTGGTAGCTTGAAGTATGCTCATCGCCG...

CDS

Download CDS FASTA

798 bp · LXL04_021283|LXL04_021283|OH1004|CDS

ATGGGTGATCATTTCGTCTTTCTGGTTGATCGGTTGCTCACCGAATCCACTTTAGAGGCTGCAATCGAAAGCAGAAACCCTTCATATCCTTTATCCCCCGCCATCGACACCATGATTGATTGTTCTTCTCATATGGATCCTCAAACTCCTTTCACCCCAAGGAAAATGGTGGAATGCAGAATATGCCAGGATGAGGATTTTGATTCGACTATGGAGACTCCTTGCTCTTGTTGTGGTAGCTTGAAGTATGCTCATCGCCG...

Protein

Download Protein FASTA

265 aa · LXL04_021283|LXL04_021283|OH1004|PROTEIN

MGDHFVFLVDRLLTESTLEAAIESRNPSYPLSPAIDTMIDCSSHMDPQTPFTPRKMVECRICQDEDFDSTMETPCSCCGSLKYAHRRCVQRWCNEKGDIICEICHQQFRPGYTAPPPVFRLGGIPANLRGHWQIARRDINADPRIITVVSSDHNLLDQEYDEYADSTARSILCFRSVAVIFMIVLILRHTLPIFAYGGANYSLPVFLLLLIRTSGFILPIYLILRAMTALVHRRRHLVSNGSTSSFSSSDEEAGPIAIQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021283`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_021283`
Location	Chr04:126534919-126536288 (-)
Description	Similar to MARCHF3: E3 ubiquitin-protein ligase MARCHF3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021283` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0002495 antigen processing and presentation of peptide antigen via MHC class II Biological Process GO:0006897 endocytosis Biological Process GO:0006955 immune response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005768 endosome Cellular Component GO:0031901 early endosome membrane Cellular Component GO:0031902 late endosome membrane Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function
KEGG gene cross-reference	bta:520348 hsa:115123 mmu:320253 rno:364878 xla:495072 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.310

Rank 1 · LXL04_021283 · OH-1004

Cell membrane0.304

Rank 2 · LXL04_021283 · OH-1004

Cytoplasm0.192

Rank 3 · LXL04_021283 · OH-1004

Endoplasmic reticulum0.188

Rank 4 · LXL04_021283 · OH-1004

Nucleus0.137

Rank 5 · LXL04_021283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12906.14RINGv59-104 aa

PF12428.14DUF3675110-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021283	`PF12906.14`	RINGv	59	104	1.8e-11	44.7
LXL04_021283	`PF12428.14`	DUF3675	110	227	5.2e-38	130.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card