LXL04_021256 | RubberDandelionOmics

Gene overview

LXL04_021256

Reference: OH-1004 Chr: Chr04 Coordinates: 125892063-125895504 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1341 bp · LXL04_021256|LXL04_021256|OH1004|cDNA

ATGGTCGGCCGTGGGGAAGGGTTTGTCTGGCTAGGGTACGGACCTGAGGGAAATTGGAAGAAAAGAGAAAAACAATATATTGTAGGAAGAGATCATAGTGAAACTCTCCCATACCATGTAtttgttggaatcttgaagttGAGAAACTCAAATTCtttaattggtatcagagctcaagaCAGGGGCTGTGAAACTGTGTACCTGAAATCGAGAAGAGGAAGAAGCTTTTACTCGAAAACAGGAAGAAATCGATCAACAAA...

CDS

Download CDS FASTA

1341 bp · LXL04_021256|LXL04_021256|OH1004|CDS

ATGGTCGGCCGTGGGGAAGGGTTTGTCTGGCTAGGGTACGGACCTGAGGGAAATTGGAAGAAAAGAGAAAAACAATATATTGTAGGAAGAGATCATAGTGAAACTCTCCCATACCATGTATTTGTTGGAATCTTGAAGTTGAGAAACTCAAATTCTTTAATTGGTATCAGAGCTCAAGACAGGGGCTGTGAAACTGTGTACCTGAAATCGAGAAGAGGAAGAAGCTTTTACTCGAAAACAGGAAGAAATCGATCAACAAA...

Protein

Download Protein FASTA

446 aa · LXL04_021256|LXL04_021256|OH1004|PROTEIN

MVGRGEGFVWLGYGPEGNWKKREKQYIVGRDHSETLPYHVFVGILKLRNSNSLIGIRAQDRGCETVYLKSRRGRSFYSKTGRNRSTKRAFRSSWKTGTVKWFNDTKGFGFISPEDGSEDLFVHQSSIRTEGFRSLGDVKSPGTRSSGGDDGLSSGGCTGGGSSSSGAMEVIPAQGDRREVDGKRQRAIGGEGGARALLTSRPTADWSGGGAGGGGSRSSGRRRREEREGEIGREEEEWGKRKPTGGFLYSGSSGGSGSGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021256`
TK1151 ID	TkA05G372780
OH-1004 ID	LXL04_021256
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 96.471 / OH-1004 36.771 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021256

Location Chr04:125892063-125895504 (-)

Description Similar to MYB4: Transcription repressor MYB4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38620`	Transcription repressor involved in regulation of protection against UV.	No verified direct reference in this release
`At1g22640`	Transcription factor MYB3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021256 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009800 cinnamic acid biosynthetic process Biological Process

GO:0009892 negative regulation of metabolic process Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:1903086 negative regulation of sinapate ester biosynthetic process Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G22640

ath:AT4G38620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.570

Rank 1 · LXL04_021256 · OH-1004

Cytoplasm0.167

Rank 2 · LXL04_021256 · OH-1004

Plastid0.163

Rank 3 · LXL04_021256 · OH-1004

Mitochondrion0.092

Rank 4 · LXL04_021256 · OH-1004

Cell membrane0.035

Rank 5 · LXL04_021256 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00313.29CSD96-136 aa

PF00249.38Myb_DNA-binding283-328 aa

PF13921.13Myb_DNA-bind_6285-343 aa

PF00249.38Myb_DNA-binding336-380 aa

PF13921.13Myb_DNA-bind_6340-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021256	`PF00313.29`	CSD	96	136	4.5e-18	65.6
LXL04_021256	`PF00249.38`	Myb_DNA-binding	283	328	5.3e-28	97.6
LXL04_021256	`PF13921.13`	Myb_DNA-bind_6	285	343	2.3e-15	57.2
LXL04_021256	`PF00249.38`	Myb_DNA-binding	336	380	5.3e-28	97.6
LXL04_021256	`PF13921.13`	Myb_DNA-bind_6	340	384	2.3e-15	57.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZP1`	Arabidopsis thaliana	Transcription repressor MYB4	61.240%	Swiss-Prot	weak database homology
`Q9S9K9`	Arabidopsis thaliana	Transcription factor MYB3	57.241%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card