LXL04_021254 | RubberDandelionOmics

Gene overview

LXL04_021254

Reference: OH-1004 Chr: Chr04 Coordinates: 125714494-125721319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4437 bp · LXL04_021254|LXL04_021254|OH1004|cDNA

ATGGCAGATTGTCAATGTGAGACAACAATTTCTGAAACTTGTAACTATTGTGCTAACATTAAAGTTACACATAAAACCATCGATCATAAAATTTATCCCTCTGATTTAAACCCTGAACCTCCATCACCAAATTTCAATGGGCCGCGTCTTCAAGCAGTATCCGTACGCCATTCATCTGGCAGGAGCGATGAAGATGACGCAGATGATTCTGCGACAAACTTCTTCAGTCCCTACAGTCTTGACACGTCAGATCTGGATTC...

CDS

Download CDS FASTA

4437 bp · LXL04_021254|LXL04_021254|OH1004|CDS

ATGGCAGATTGTCAATGTGAGACAACAATTTCTGAAACTTGTAACTATTGTGCTAACATTAAAGTTACACATAAAACCATCGATCATAAAATTTATCCCTCTGATTTAAACCCTGAACCTCCATCACCAAATTTCAATGGGCCGCGTCTTCAAGCAGTATCCGTACGCCATTCATCTGGCAGGAGCGATGAAGATGACGCAGATGATTCTGCGACAAACTTCTTCAGTCCCTACAGTCTTGACACGTCAGATCTGGATTC...

Protein

Download Protein FASTA

1478 aa · LXL04_021254|LXL04_021254|OH1004|PROTEIN

MADCQCETTISETCNYCANIKVTHKTIDHKIYPSDLNPEPPSPNFNGPRLQAVSVRHSSGRSDEDDADDSATNFFSPYSLDTSDLDSSSVSTKRDFNSFTSLNSSPSDSPSKIQEQQHISALKSHDHSQSYDDFSIFQQQCDNSSHSHKPLDFETNDLIWFPPPSHDQNDDDTNFFSYNDDDDDDETGEIVLSSSEPLKTVVQGHFRALVSQLLQSEFNSMEKWVDIVTSLAWQAAHYVKPDTSRGGSMDPGDYVKIKCI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021254`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021254

Location Chr04:125714494-125721319 (+)

Description Similar to FAB1C: Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71010`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At3g14270`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	Arabidopsis FAB1/PIKfyve proteins are essential for development of viable pollen.2009 · DOI: 10.1104/pp.109.146159 Loss-of-function and gain-of-function mutations in FAB1A/B impair endomembrane homeostasis, conferring pleiotropic developmental abnormalities in Arabidopsis.2011 · DOI: 10.1104/pp.110.167981
`At4g33240`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	Arabidopsis FAB1/PIKfyve proteins are essential for development of viable pollen.2009 · DOI: 10.1104/pp.109.146159 Loss-of-function and gain-of-function mutations in FAB1A/B impair endomembrane homeostasis, conferring pleiotropic developmental abnormalities in Arabidopsis.2011 · DOI: 10.1104/pp.110.167981 Arabidopsis FAB1A/B is possibly involved in the recycling of auxin transporters.2011 · DOI: 10.4161/psb.6.4.15023
`At1g34260`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021254 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007033 vacuole organization Biological Process

GO:0009555 pollen development Biological Process

GO:0010256 endomembrane system organization Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0000285 1-phosphatidylinositol-3-phosphate 5-kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G71010

ath:AT3G14270

ath:AT4G33240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.389

Rank 1 · LXL04_021254 · OH-1004

Nucleus0.332

Rank 2 · LXL04_021254 · OH-1004

Cell membrane0.272

Rank 3 · LXL04_021254 · OH-1004

Plastid0.070

Rank 4 · LXL04_021254 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_021254 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118.30Cpn60_TCP1212-470 aa

PF01504.25PIP5K1193-1360 aa

PF01504.25PIP5K1357-1415 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021254	`PF00118.30`	Cpn60_TCP1	212	470	9.9e-31	107.7
LXL04_021254	`PF01504.25`	PIP5K	1193	1360	4.3e-45	154.9
LXL04_021254	`PF01504.25`	PIP5K	1357	1415	4.3e-45	154.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSJ8`	Arabidopsis thaliana	Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C	57.470%	Swiss-Prot	moderate database homology
`Q9LUM0`	Arabidopsis thaliana	1-phosphatidylinositol-3-phosphate 5-kinase FAB1B	47.170%	Swiss-Prot	moderate database homology
`Q0WUR5`	Arabidopsis thaliana	1-phosphatidylinositol-3-phosphate 5-kinase FAB1A	48.085%	Swiss-Prot	moderate database homology
`Q9XID0`	Arabidopsis thaliana	Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D	53.521%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card