LXL04_021157 | RubberDandelionOmics

Gene overview

LXL04_021157

Reference: OH-1004 Chr: Chr04 Coordinates: 122881146-122882856 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1212 bp · LXL04_021157|LXL04_021157|OH1004|cDNA

TCGTATTTGAAGATGTATGTAGTGGACAGCAGAGGAGGAGCCATAGCATGCATGCTTCTCGCACTCTTCTTCTTAGGAACATGGCCCGCCATTCTAACACTCTTAGAAAGACGCGGCCGACTTCCTCAACACACTTACCTCGATTACACAATCACCAATCTTTTAGCCGCTGTCATAATCGCTTTCACATTCGGAGAATTAGGCCATACCAATGACGATAAACCCAATTTCCTAATCCAGCTTTCTCAGAATAATTGGCC...

CDS

Download CDS FASTA

1206 bp · LXL04_021157|LXL04_021157|OH1004|CDS

TTGAAGATGTATGTAGTGGACAGCAGAGGAGGAGCCATAGCATGCATGCTTCTCGCACTCTTCTTCTTAGGAACATGGCCCGCCATTCTAACACTCTTAGAAAGACGCGGCCGACTTCCTCAACACACTTACCTCGATTACACAATCACCAATCTTTTAGCCGCTGTCATAATCGCTTTCACATTCGGAGAATTAGGCCATACCAATGACGATAAACCCAATTTCCTAATCCAGCTTTCTCAGAATAATTGGCCAAGCGT...

Protein

Download Protein FASTA

401 aa · LXL04_021157|LXL04_021157|OH1004|PROTEIN

MKMYVVDSRGGAIACMLLALFFLGTWPAILTLLERRGRLPQHTYLDYTITNLLAAVIIAFTFGELGHTNDDKPNFLIQLSQNNWPSVLFAMAGGVVLSLGNLSTQYAWAFVGLSVTEVMTSSITVVIGTTLNYFLDDKINRAEILFPGVACFLIAVCLGSAVHASNAKDNKVKLEKLQAAKNGSISNGSKTISKNDLENGISKPEKAKAGTAGFLIELESRRSIKVFGRSTLIGLGICLFAGICFSLFSPAFNLATNDQW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021157`
TK1151 ID	TkA05G358620
OH-1004 ID	LXL04_021157
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 99.501 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021157

Location Chr04:122881146-122882856 (+)

Description Similar to UPS2: Ureide permease 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03530`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine.	UPS1 and UPS2 from Arabidopsis mediate high affinity transport of uracil and 5-fluorouracil.2004 · DOI: 10.1074/jbc.m405433200
`At2g03590`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine.	A novel superfamily of transporters for allantoin and other oxo derivatives of nitrogen heterocyclic compounds in Arabidopsis.2002 · DOI: 10.1105/tpc.010458 UPS1 and UPS2 from Arabidopsis mediate high affinity transport of uracil and 5-fluorouracil.2004 · DOI: 10.1074/jbc.m405433200 Heterologous expression of a plant uracil transporter in yeast: improvement of plasma membrane targeting in mutants of the Rsp5p ubiquitin protein ligase.2006 · DOI: 10.1002/biot.200500034
`At2g03520`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds.	No verified direct reference in this release
`At1g26440`	Proton-coupled transporter that transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine.	Comparative studies on Ureide Permeases in Arabidopsis thaliana and analysis of two alternative splice variants of AtUPS5.2006 · DOI: 10.1007/s00425-006-0315-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021157 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0015720 allantoin transport Biological Process

GO:0015857 uracil transport Biological Process

GO:0043100 pyrimidine nucleobase salvage Biological Process

GO:0071705 nitrogen compound transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

GO:0016020 membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G26440

ath:AT2G03520

ath:AT2G03530

ath:AT2G03590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.445

Rank 1 · LXL04_021157 · OH-1004

Lysosome / Vacuole0.195

Rank 2 · LXL04_021157 · OH-1004

Endoplasmic reticulum0.172

Rank 3 · LXL04_021157 · OH-1004

Cytoplasm0.160

Rank 4 · LXL04_021157 · OH-1004

Golgi apparatus0.140

Rank 5 · LXL04_021157 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07168.18Ureide_permease43-395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021157	`PF07168.18`	Ureide_permease	43	395	7.4e-192	637.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ89`	Arabidopsis thaliana	Ureide permease 2	76.000%	Swiss-Prot	strong database homology
`Q9ZPR7`	Arabidopsis thaliana	Ureide permease 1	76.382%	Swiss-Prot	strong database homology
`Q9ZQ88`	Arabidopsis thaliana	Ureide permease 4	70.574%	Swiss-Prot	strong database homology
`Q93Z75`	Arabidopsis thaliana	Ureide permease 5	64.477%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card