RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_021120
Reference: OH-1004 Chr: Chr04 Coordinates: 122062981-122068508 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2130 bp · LXL04_021120|LXL04_021120|OH1004|cDNA

ATGTGTTGTCGATTTCACGAGTTGGAGACGAGAGGTAGAAGGATGGTGGTCCTGCTTCGGCGATTTGGATGGTGGTCGTCTCCATCTGCCTCCTGCGGCTCTCTCTCCCGCGATGGGTTTGAAGGCTGCCGATGGTTTGAAGGTAAGGCGAGAGAAGTCGAGACCTGTTCCGATTGCAGCTCCGATTGCATCGATGGAGAGGGTCTGATCGATCTCCCTCGTGTCCTTCTCAGTCTCGCGATGGGGTTGAAGGTAAGAGG...

CDS

Download CDS FASTA

2130 bp · LXL04_021120|LXL04_021120|OH1004|CDS

ATGTGTTGTCGATTTCACGAGTTGGAGACGAGAGGTAGAAGGATGGTGGTCCTGCTTCGGCGATTTGGATGGTGGTCGTCTCCATCTGCCTCCTGCGGCTCTCTCTCCCGCGATGGGTTTGAAGGCTGCCGATGGTTTGAAGGTAAGGCGAGAGAAGTCGAGACCTGTTCCGATTGCAGCTCCGATTGCATCGATGGAGAGGGTCTGATCGATCTCCCTCGTGTCCTTCTCAGTCTCGCGATGGGGTTGAAGGTAAGAGG...

Protein

Download Protein FASTA

709 aa · LXL04_021120|LXL04_021120|OH1004|PROTEIN

MCCRFHELETRGRRMVVLLRRFGWWSSPSASCGSLSRDGFEGCRWFEGKAREVETCSDCSSDCIDGEGLIDLPRVLLSLAMGLKVRGDQALDPVFEELGNGGRVRKGEPISGKHPTLSALKELHTLLIVNGHSTQLNLQTKLVSLYGSLGDTKSARLVFDQIPHPDMFSCKVMIRWYFLNDSHFETIMFYRCMTKCLKEHDNVVFSIVVKACTKLRDINEGKKIHCHIVKAGSPDGFVLTSLVDMYAKCGHINCSRKVFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_021120
TK1151 IDTkA05G355380
OH-1004 IDLXL04_021120
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)98.800
Protein coverage (%)TK1151 100.000 / OH-1004 72.355
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_021120
LocationChr04:122062981-122068508 (-)
DescriptionSimilar to PCMP-E47: Pentatricopeptide repeat-containing protein At2g03380, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g03380 Pentatricopeptide repeat-containing protein At2g03380, mitochondrial. No verified direct reference in this release
At1g11290 Involved in multiple sites RNA editing events in chloroplasts.
Pentatricopeptide repeat proteins with the DYW motif have distinct molecular functions in RNA editing and RNA cleavage in Arabidopsis chloroplasts.2009 · DOI: 10.1105/tpc.108.064667
At4g18750 Plays a major role in single RNA editing events in chloroplasts.
Identification of two pentatricopeptide repeat genes required for RNA editing and zinc binding by C-terminal cytidine deaminase-like domains.2013 · DOI: 10.1074/jbc.m113.485755
At4g33990 Pentatricopeptide repeat-containing protein At4g33990. No verified direct reference in this release
At3g01580 Putative pentatricopeptide repeat-containing protein At3g01580. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021120 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006397 mRNA processing Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0009451 RNA modification Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010087 phloem or xylem histogenesis Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0010588 cotyledon vascular tissue pattern formation Biological Process
GO:0016556 mRNA modification Biological Process
GO:0048366 leaf development Biological Process
GO:1900865 chloroplast RNA modification Biological Process
GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference
ath:AT1G11290
ath:AT2G03380
ath:AT4G18750
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.667
Rank 1 · LXL04_021120 · OH-1004
Plastid0.204
Rank 2 · LXL04_021120 · OH-1004
Nucleus0.047
Rank 3 · LXL04_021120 · OH-1004
Cytoplasm0.036
Rank 4 · LXL04_021120 · OH-1004
Cell membrane0.008
Rank 5 · LXL04_021120 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2265-314 aa
PF01535.27PPR268-295 aa
PF13041.13PPR_2374-421 aa
PF01535.27PPR376-398 aa
PF13041.13PPR_2474-518 aa
PF01535.27PPR476-506 aa
PF13041.13PPR_2571-619 aa
PF13812.13PPR_3572-618 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_021120PF13041.13PPR_22653141.2e-58195.7
LXL04_021120PF01535.27PPR2682952.9e-61200.2
LXL04_021120PF13041.13PPR_23744211.2e-58195.7
LXL04_021120PF01535.27PPR3763982.9e-61200.2
LXL04_021120PF13041.13PPR_24745181.2e-58195.7
LXL04_021120PF01535.27PPR4765062.9e-61200.2
LXL04_021120PF13041.13PPR_25716191.2e-58195.7
LXL04_021120PF13812.13PPR_35726184.2e-2175.5
LXL04_021120PF01535.27PPR5746032.9e-61200.2
LXL04_021120PF29070.1MSC6_N5766675.1e-1556.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZQ74Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g03380, mitochondrial50.596%Swiss-Protstrong database homology
Q3E6Q1Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g11290, chloroplastic35.862%Swiss-Protmoderate database homology
Q9SN39Arabidopsis thalianaPentatricopeptide repeat-containing protein DOT4, chloroplastic34.536%Swiss-Protmoderate database homology
O81767Arabidopsis thalianaPentatricopeptide repeat-containing protein At4g3399033.178%Swiss-Protmoderate database homology
Q9SS97Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At3g0158034.838%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser