LXL04_020951 | RubberDandelionOmics

Gene overview

LXL04_020951

Reference: OH-1004 Chr: Chr04 Coordinates: 116232328-116235532 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1686 bp · LXL04_020951|LXL04_020951|OH1004|cDNA

ATGATTCTTCAACGTTCGATTCCGATTCTCAGTTTCTGCAAATCAACTTCATTATCATCCTCCCCCAAATTCCTCTTCTTACCTTTCAACTCATCACCACAAACATTTCGtttccaccaccaccaccaccaccgcagCCAAATCAGGGCCTTTActgccaccaccaccaccgatGAAAAGGAAACCGATACCTTCTTTGCAGACGACACTGTTTCCTGGACATCCCTTGGGGTTGTTGACAGACTCTCCCAATCTCTTTC...

CDS

Download CDS FASTA

1686 bp · LXL04_020951|LXL04_020951|OH1004|CDS

ATGATTCTTCAACGTTCGATTCCGATTCTCAGTTTCTGCAAATCAACTTCATTATCATCCTCCCCCAAATTCCTCTTCTTACCTTTCAACTCATCACCACAAACATTTCGTTTCCACCACCACCACCACCACCGCAGCCAAATCAGGGCCTTTACTGCCACCACCACCACCGATGAAAAGGAAACCGATACCTTCTTTGCAGACGACACTGTTTCCTGGACATCCCTTGGGGTTGTTGACAGACTCTCCCAATCTCTTTC...

Protein

Download Protein FASTA

561 aa · LXL04_020951|LXL04_020951|OH1004|PROTEIN

MILQRSIPILSFCKSTSLSSSPKFLFLPFNSSPQTFRFHHHHHHRSQIRAFTATTTTDEKETDTFFADDTVSWTSLGVVDRLSQSLSRIGLNRPSLIQALSIPPILHGHDVVVAAETGSGKTHGYLVPLFHNLSTTTNETVNRPHKSLVLCPNVMLCEQVVRMANYICNDNGEPLLKVAAVCGRQGWPVHEPNIIVSTPAALLNYLHAIDPERRRRADFIRDVKHVVFDEADMLLCGSFQNQVIRLINMFRFDEKLLSRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020951`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020951

Location Chr04:116232328-116235532 (+)

Description Similar to RH22: DEAD-box ATP-dependent RNA helicase 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g59990`	DEAD-box ATP-dependent RNA helicase 22.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0383400`	DEAD-box ATP-dependent RNA helicase 22.	No verified direct reference in this release
`Os03g0708600`	ATP-dependent RNA helicase involved in mRNA splicing.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020951 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006364 rRNA processing Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0071013 catalytic step 2 spliceosome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G59990

cnb:CNBL0260

cne:CNH00280

dosa:Os03g0708600

dosa:Os09g0383400

osa:4333866

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.483

Rank 1 · LXL04_020951 · OH-1004

Mitochondrion0.414

Rank 2 · LXL04_020951 · OH-1004

Nucleus0.084

Rank 3 · LXL04_020951 · OH-1004

Cytoplasm0.038

Rank 4 · LXL04_020951 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_020951 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD97-251 aa

PF00271.38Helicase_C389-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020951	`PF00270.36`	DEAD	97	251	4.6e-25	89.0
LXL04_020951	`PF00271.38`	Helicase_C	389	496	3.5e-23	82.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944S1`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 22	55.070%	Swiss-Prot	strong database homology
`Q6H601`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 22	58.367%	Swiss-Prot	strong database homology
`Q53RK8`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 21	26.432%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card