LXL04_020881 | RubberDandelionOmics

Gene overview

LXL04_020881

Reference: OH-1004 Chr: Chr04 Coordinates: 112801679-112802238 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · LXL04_020881|LXL04_020881|OH1004|cDNA

ATGGATTCTACTTGGGACCTGATTCGGAGTTTTGCTCCCAGAGATAACGAAGATGAACCAGCTGGGGGATTCTATCGTCAAATGAGCTACCCAATAATCGATGTAACTGGTTCAGATACGCCGAATGATGAGGATGAGGAATCCTTTACTGCACCTGCTGAACATGAATATTCCCTTTCGTCCATTGGATATTTTGACAGTTTCAAAAACTGGCAGAAGGGCAATTTTCTTGGAAGTGGTTCATTTGGCACTGTTTACGA...

CDS

Download CDS FASTA

501 bp · LXL04_020881|LXL04_020881|OH1004|CDS

ATGGATTCTACTTGGGACCTGATTCGGAGTTTTGCTCCCAGAGATAACGAAGATGAACCAGCTGGGGGATTCTATCGTCAAATGAGCTACCCAATAATCGATGTAACTGGTTCAGATACGCCGAATGATGAGGATGAGGAATCCTTTACTGCACCTGCTGAACATGAATATTCCCTTTCGTCCATTGGATATTTTGACAGTTTCAAAAACTGGCAGAAGGGCAATTTTCTTGGAAGTGGTTCATTTGGCACTGTTTACGA...

Protein

Download Protein FASTA

166 aa · LXL04_020881|LXL04_020881|OH1004|PROTEIN

MDSTWDLIRSFAPRDNEDEPAGGFYRQMSYPIIDVTGSDTPNDEDEESFTAPAEHEYSLSSIGYFDSFKNWQKGNFLGSGSFGTVYEGFNEYVKFEYHVISSYIHKWTGNLFAVKEVSLLDQGSQGKQIIFQLEQEISLLSQFHHENIVRYLGTDTTRESGDRQSW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020881`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020881

Location Chr04:112801679-112802238 (+)

Description Similar to MEKK1: Mitogen-activated protein kinase kinase kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08500`	The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.	MAP kinase signalling cascade in Arabidopsis innate immunity.2002 · DOI: 10.1038/415977a The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023 Phosphorylation of Arabidopsis thaliana MEKK1 via Ca(2+) signaling as a part of the cold stress response.2013 · DOI: 10.1007/s10265-013-0576-0
`At4g08480`	Triggers SUMM2-mediated immune responses, including cell death and defense responses.	The MEKK1-MKK1/MKK2-MPK4 kinase cascade negatively regulates immunity mediated by a mitogen-activated protein kinase kinase kinase in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097253 Glutamate signalling via a MEKK1 kinase-dependent pathway induces changes in Arabidopsis root architecture.2013 · DOI: 10.1111/tpj.12201 Deletion of a tandem gene family in Arabidopsis: increased MEKK2 abundance triggers autoimmunity when the MEKK1-MKK1/2-MPK4 signaling cascade is disrupted.2013 · DOI: 10.1105/tpc.113.112102
`At4g12020`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020881 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009611 response to wounding Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010200 response to chitin Biological Process

GO:0010449 root meristem growth Biological Process

GO:0022622 root system development Biological Process

KEGG gene cross-reference

ath:AT4G08480

ath:AT4G08500

ath:AT4G12020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566

Rank 1 · LXL04_020881 · OH-1004

Nucleus0.403

Rank 2 · LXL04_020881 · OH-1004

Cell membrane0.119

Rank 3 · LXL04_020881 · OH-1004

Mitochondrion0.064

Rank 4 · LXL04_020881 · OH-1004

Golgi apparatus0.061

Rank 5 · LXL04_020881 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase72-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020881	`PF00069.32`	Pkinase	72	154	1.3e-07	32.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39008`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 1	37.222%	Swiss-Prot	moderate database homology
`O81472`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 9	53.488%	Swiss-Prot	moderate database homology
`Q9SZ67`	Arabidopsis thaliana	Probable WRKY transcription factor 19	38.272%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card