LXL04_020846 | RubberDandelionOmics

Gene overview

LXL04_020846

Reference: OH-1004 Chr: Chr04 Coordinates: 110919346-110926018 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3555 bp · LXL04_020846|LXL04_020846|OH1004|cDNA

atggcgttagaagacttgGTGGAATATGAAGCAGCACGTGGTGAACTATATGAGGAAGTTTCTAGGGGCAGTTCCATAGAGGACATAAGAGCAAGGCTAACTAAAAAAGATGATACAAATACAAGTTCCAAAAAAGATACTGACATAcataagaaaaaaaatacacAAGGAGAGACAAAAACAAAGGTTCAAAAGCAGCAGGAAACAAGAACTTACTCTGTTCACAGCATTCAAAGAAAGAAGAGGGACCTAATGCAACT...

CDS

Download CDS FASTA

3555 bp · LXL04_020846|LXL04_020846|OH1004|CDS

ATGGCGTTAGAAGACTTGGTGGAATATGAAGCAGCACGTGGTGAACTATATGAGGAAGTTTCTAGGGGCAGTTCCATAGAGGACATAAGAGCAAGGCTAACTAAAAAAGATGATACAAATACAAGTTCCAAAAAAGATACTGACATACATAAGAAAAAAAATACACAAGGAGAGACAAAAACAAAGGTTCAAAAGCAGCAGGAAACAAGAACTTACTCTGTTCACAGCATTCAAAGAAAGAAGAGGGACCTAATGCAACT...

Protein

Download Protein FASTA

1184 aa · LXL04_020846|LXL04_020846|OH1004|PROTEIN

MALEDLVEYEAARGELYEEVSRGSSIEDIRARLTKKDDTNTSSKKDTDIHKKKNTQGETKTKVQKQQETRTYSVHSIQRKKRDLMQLLNKHIPVSVKSVEDETSMTPKTLSAVELFSKAIEEQSGIDIVNKKTFRVADEELLVLVTKASSKIKVHLATGFKEPLTLHWALSKKAGEWLANTLAPPENLLPQGSTSLATSADTPFSTISIDGSTNTIQSLEIEIGEGSYVGMPFVMFSGNNWIKNNGSDFYIEFSAPKKAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020846`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020846

Location Chr04:110919346-110926018 (-)

Description Similar to R1: Alpha-glucan water dikinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10760`	Mediates the incorporation of phosphate into starch-like alpha-glucan, mostly at the C-6 position of glucose units.	The Arabidopsis sex1 mutant is defective in the R1 protein, a general regulator of starch degradation in plants, and not in the chloroplast hexose transporter.2001 · DOI: 10.1105/tpc.010091
`At4g24450`	Mediates the incorporation of phosphate into alpha-glucan, mostly at the C-6 position of glucose units.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0297500`	Mediates the incorporation of phosphate into starch-like phospho-alpha-glucan, mostly at the C-3 position of glucose units.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020846 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005982 starch metabolic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009631 cold acclimation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004673 protein histidine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ag:CAA70725

ath:AT1G10760

ath:AT4G24450

dosa:Os12g0297500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.420

Rank 1 · LXL04_020846 · OH-1004

Endoplasmic reticulum0.157

Rank 2 · LXL04_020846 · OH-1004

Plastid0.157

Rank 3 · LXL04_020846 · OH-1004

Golgi apparatus0.139

Rank 4 · LXL04_020846 · OH-1004

Nucleus0.133

Rank 5 · LXL04_020846 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23229.3DUF70676-36 aa

PF23166.2Ig_N_CWD1131-253 aa

PF22973.3GWD1_pHisD727-839 aa

PF01326.25PPDK_N981-1183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020846	`PF23229.3`	DUF7067	6	36	1.6e-07	31.7
LXL04_020846	`PF23166.2`	Ig_N_CWD1	131	253	1.2e-22	81.1
LXL04_020846	`PF22973.3`	GWD1_pHisD	727	839	1.3e-53	180.2
LXL04_020846	`PF01326.25`	PPDK_N	981	1183	2.2e-25	90.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAC6`	Arabidopsis thaliana	Alpha-glucan water dikinase 1, chloroplastic	70.954%	Swiss-Prot	strong database homology
`Q9STV0`	Arabidopsis thaliana	Alpha-glucan water dikinase 2	49.494%	Swiss-Prot	moderate database homology
`Q2QTC2`	Oryza sativa subsp. japonica	Phosphoglucan, water dikinase, chloroplastic	28.480%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card