LXL04_020822 | RubberDandelionOmics

Gene overview

LXL04_020822

Reference: OH-1004 Chr: Chr04 Coordinates: 110215718-110222482 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3726 bp · LXL04_020822|LXL04_020822|OH1004|cDNA

ATGGCAAAAAAGGGTGGCATGTTCTATTATGCAGATGGAATAGATAAAGTTCTTTTGTTATTTGGGACAATAGGTTCCATTGGAGATGGGTTGATGTCTCCTCTTACAATGGTGATCCTTAGTGGGATCATTGATGAGTATGGAACTGGTGGCGTTAATATTTCCCTTGATGTGGTGGACAAGTTTGCGATCAAGCTCCTCATCCTTGCAATTGGCATTGCAACATCAGCTTTCATTGAGGGCATTTGTTGGACAAGAAC...

CDS

Download CDS FASTA

3723 bp · LXL04_020822|LXL04_020822|OH1004|CDS

ATGGCAAAAAAGGGTGGCATGTTCTATTATGCAGATGGAATAGATAAAGTTCTTTTGTTATTTGGGACAATAGGTTCCATTGGAGATGGGTTGATGTCTCCTCTTACAATGGTGATCCTTAGTGGGATCATTGATGAGTATGGAACTGGTGGCGTTAATATTTCCCTTGATGTGGTGGACAAGTTTGCGATCAAGCTCCTCATCCTTGCAATTGGCATTGCAACATCAGCTTTCATTGAGGGCATTTGTTGGACAAGAAC...

Protein

Download Protein FASTA

1240 aa · LXL04_020822|LXL04_020822|OH1004|PROTEIN

MAKKGGMFYYADGIDKVLLLFGTIGSIGDGLMSPLTMVILSGIIDEYGTGGVNISLDVVDKFAIKLLILAIGIATSAFIEGICWTRTAERQTSRLRMEYLKSVLRQEVSFFDTQVGSSTNFEVITAISGDAQLIQDVMADKLPNCLAHLSSVVSSIIVGFILSWRLSIASLPFALLFVVPVLGIGVILKGLGMKMQGAYNTGGGVAEQAISSIRTVYSYVGEQQTIAKFSNALQTSMELGIQQGLTKGLMIGSMGMIFVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020822`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020822

Location Chr04:110215718-110222482 (+)

Description Similar to Os02g0190300: Putative multidrug resistance protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28345`	ABC transporter B family member 15.	No verified direct reference in this release
`At3g28390`	ABC transporter B family member 18.	No verified direct reference in this release
`At3g28380`	ABC transporter B family member 17.	No verified direct reference in this release
`At3g28360`	ABC transporter B family member 16.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0190300`	Putative multidrug resistance protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020822 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0055085 transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G28345

ath:AT3G28360

ath:AT3G28380

ath:AT3G28390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.547

Rank 1 · LXL04_020822 · OH-1004

Lysosome / Vacuole0.194

Rank 2 · LXL04_020822 · OH-1004

Endoplasmic reticulum0.131

Rank 3 · LXL04_020822 · OH-1004

Cytoplasm0.125

Rank 4 · LXL04_020822 · OH-1004

Mitochondrion0.063

Rank 5 · LXL04_020822 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane19-286 aa

PF00005.34ABC_tran361-510 aa

PF02463.26SMC_N462-552 aa

PF00664.29ABC_membrane687-947 aa

PF00005.34ABC_tran1017-1166 aa

PF02463.26SMC_N1061-1209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020822	`PF00664.29`	ABC_membrane	19	286	9e-85	285.4
LXL04_020822	`PF00005.34`	ABC_tran	361	510	1.8e-68	230.1
LXL04_020822	`PF02463.26`	SMC_N	462	552	1e-11	45.4
LXL04_020822	`PF00664.29`	ABC_membrane	687	947	9e-85	285.4
LXL04_020822	`PF00005.34`	ABC_tran	1017	1166	1.8e-68	230.1
LXL04_020822	`PF02463.26`	SMC_N	1061	1209	1e-11	45.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHD1`	Arabidopsis thaliana	ABC transporter B family member 15	54.450%	Swiss-Prot	strong database homology
`Q9LSJ5`	Arabidopsis thaliana	ABC transporter B family member 18	51.858%	Swiss-Prot	strong database homology
`Q9LSJ6`	Arabidopsis thaliana	ABC transporter B family member 17	51.735%	Swiss-Prot	strong database homology
`Q9LSJ8`	Arabidopsis thaliana	ABC transporter B family member 16	51.208%	Swiss-Prot	strong database homology
`Q6YUU5`	Oryza sativa subsp. japonica	Putative multidrug resistance protein	53.989%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card