LXL04_020725 | RubberDandelionOmics

Gene overview

LXL04_020725

Reference: OH-1004 Chr: Chr04 Coordinates: 106989713-106994265 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1629 bp · LXL04_020725|LXL04_020725|OH1004|cDNA

ATGATTTCAATCGACACCCATCTAGCTGTTCAATCGACTTCAAATGATGGCAGAATCGATTTCAATCGAATTCAAAGAAACCAGAGGAGAAACATTACCGTCGATGGAGGAGAGGTGCGTCGACCGGTCTCAGAGAGTGGCGTCGACTGGAGGAGGGCAGAGGTCCGAGGTGTTGCTCTAGTGAAGAAGGATGGAGACCGGTTGATGTCccgattgaagaagaagaaaacggAAGAAGCTGCGTCGCGGTTGATGTCccg...

CDS

Download CDS FASTA

1629 bp · LXL04_020725|LXL04_020725|OH1004|CDS

ATGATTTCAATCGACACCCATCTAGCTGTTCAATCGACTTCAAATGATGGCAGAATCGATTTCAATCGAATTCAAAGAAACCAGAGGAGAAACATTACCGTCGATGGAGGAGAGGTGCGTCGACCGGTCTCAGAGAGTGGCGTCGACTGGAGGAGGGCAGAGGTCCGAGGTGTTGCTCTAGTGAAGAAGGATGGAGACCGGTTGATGTCCCGATTGAAGAAGAAGAAAACGGAAGAAGCTGCGTCGCGGTTGATGTCCCG...

Protein

Download Protein FASTA

542 aa · LXL04_020725|LXL04_020725|OH1004|PROTEIN

MISIDTHLAVQSTSNDGRIDFNRIQRNQRRNITVDGGEVRRPVSESGVDWRRAEVRGVALVKKDGDRLMSRLKKKKTEEAASRLMSRLKKKKTEEAASRGGCPSDYVALSVSIISFVFLFLRSTLPFIIHKVPRPKGSSFWLPTVQIIASFNLLLSLAMSLNIVRFHRRHWWQSCYLWGVWVNGPLGFGLLLSSRLIQVTHLYFVFVKRRLFPIRSYISLPLALLPWVAWAALLEIKQPINNHCHMGTQWAVPHMSLPVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020725`
TK1151 ID	TkA05G298950
OH-1004 ID	LXL04_020725
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 98.444 / OH-1004 81.734 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020725

Location Chr04:106989713-106994265 (+)

Description Similar to RGS1: Regulator of G-protein signaling 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26090`	Glucose-regulated GTPase-accelerating protein (GAP) for the GTP-bound self-activating heterotrimeric G alpha protein GPA1.	A seven-transmembrane RGS protein that modulates plant cell proliferation.2003 · DOI: 10.1126/science.1087790 The regulator of G-protein signaling proteins involved in sugar and abscisic acid signaling in Arabidopsis seed germination.2006 · DOI: 10.1104/pp.105.069872 Overexpression of the regulator of G-protein signalling protein enhances ABA-mediated inhibition of root elongation and drought tolerance in Arabidopsis.2006 · DOI: 10.1093/jxb/erj167 GTPase acceleration as the rate-limiting step in Arabidopsis G protein-coupled sugar signaling.2007 · DOI: 10.1073/pnas.0704751104 Abscisic acid regulation of guard-cell K+ and anion channels in Gbeta- and RGS-deficient Arabidopsis lines.2008 · DOI: 10.1073/pnas.0800980105 D-Glucose sensing by a plasma membrane regulator of G signaling protein, AtRGS1.2008 · DOI: 10.1016/j.febslet.2008.08.038 Functional reconstitution of an atypical G protein heterotrimer and regulator of G protein signaling protein (RGS1) from Arabidopsis thaliana.2011 · DOI: 10.1074/jbc.m110.190355 Endocytosis of the seven-transmembrane RGS1 protein activates G-protein-coupled signalling in Arabidopsis.2012 · DOI: 10.1038/ncb2568 Cooperative control between AtRGS1 and AtHXK1 in a WD40-repeat protein pathway in Arabidopsis thaliana.2015 · DOI: 10.3389/fpls.2015.00851

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020725 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009749 response to glucose Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0045744 negative regulation of G protein-coupled receptor signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT3G26090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.617

Rank 1 · LXL04_020725 · OH-1004

Endoplasmic reticulum0.159

Rank 2 · LXL04_020725 · OH-1004

Cytoplasm0.135

Rank 3 · LXL04_020725 · OH-1004

Lysosome / Vacuole0.103

Rank 4 · LXL04_020725 · OH-1004

Golgi apparatus0.075

Rank 5 · LXL04_020725 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00615.25RGS387-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020725	`PF00615.25`	RGS	387	503	1.4e-14	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1F2`	Arabidopsis thaliana	Regulator of G protein signaling 1	58.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card