LXL04_020651 | RubberDandelionOmics

Gene overview

LXL04_020651

Reference: OH-1004 Chr: Chr04 Coordinates: 101669385-101671787 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · LXL04_020651|LXL04_020651|OH1004|cDNA

ATGAGGAAGGGGAGGAGTATTCTGTGTATTGTAAAAGAGGGAAAAGAGGATCCATGGAGGACCGATATTCTGCCGTTGTTGATCTTCAAGGAGATACCAAACAGAAAGCTGATTAAAGCCATTGACGAGTATGAAGGTGAAGATCCTCTACAACCATGGTTTGCCTGTATCAAGTGGGTACAAGATGCTTTTCCACCTGGTGGAGACTGCTCAGGATTGGTGGTTATTCTTGAACAATGTGTACGGACCTTTTGGCATGA...

CDS

Download CDS FASTA

906 bp · LXL04_020651|LXL04_020651|OH1004|CDS

ATGAGGAAGGGGAGGAGTATTCTGTGTATTGTAAAAGAGGGAAAAGAGGATCCATGGAGGACCGATATTCTGCCGTTGTTGATCTTCAAGGAGATACCAAACAGAAAGCTGATTAAAGCCATTGACGAGTATGAAGGTGAAGATCCTCTACAACCATGGTTTGCCTGTATCAAGTGGGTACAAGATGCTTTTCCACCTGGTGGAGACTGCTCAGGATTGGTGGTTATTCTTGAACAATGTGTACGGACCTTTTGGCATGA...

Protein

Download Protein FASTA

301 aa · LXL04_020651|LXL04_020651|OH1004|PROTEIN

MRKGRSILCIVKEGKEDPWRTDILPLLIFKEIPNRKLIKAIDEYEGEDPLQPWFACIKWVQDAFPPGGDCSGLVVILEQCVRTFWHEEQYKNDIRYLKVWLEYAGYCDDAEVVYGFLNTNKIGEMHAIFYISYATHLESKNKIKTGNNIYECGIARNAQPIEKLKSAYRKFFTRSMSRPKAIEEESMDTCQPTRSFGTILTKADSGNRPLDSCEIARKRQKQEGELHIMDGCFFLTQITTIGSSPGFEDGEFESSKIMRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020651`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020651

Location Chr04:101669385-101671787 (+)

Description Similar to BUBR1: Mitotic spindle checkpoint protein BUBR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33560`	Essential component of the mitotic checkpoint.	Spindle assembly checkpoint protein dynamics reveal conserved and unsuspected roles in plant cell division.2009 · DOI: 10.1371/journal.pone.0006757

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020651 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007091 metaphase/anaphase transition of mitotic cell cycle Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0045841 negative regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0051754 meiotic sister chromatid cohesion, centromeric Biological Process

GO:0071459 protein localization to chromosome, centromeric region Biological Process

GO:0000776 kinetochore Cellular Component

GO:0000940 outer kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005680 anaphase-promoting complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005813 centrosome Cellular Component

KEGG gene cross-reference

ath:AT2G33560

ddi:DDB_G0292676

hsa:701

mmu:12236

spo:2539219

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.592

Rank 1 · LXL04_020651 · OH-1004

Cytoplasm0.412

Rank 2 · LXL04_020651 · OH-1004

Mitochondrion0.052

Rank 3 · LXL04_020651 · OH-1004

Cell membrane0.050

Rank 4 · LXL04_020651 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_020651 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08311.19Mad3_BUB1_I35-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020651	`PF08311.19`	Mad3_BUB1_I	35	154	1.6e-42	145.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22806`	Arabidopsis thaliana	Mitotic spindle checkpoint protein BUBR1	61.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card