LXL04_020286 | RubberDandelionOmics

Gene overview

LXL04_020286

Reference: OH-1004 Chr: Chr04 Coordinates: 63800102-63807077 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2541 bp · LXL04_020286|LXL04_020286|OH1004|cDNA

ATGCTTGGCAAGGAATTTTTCACCGAGTATGGTGAAGCAAGTCTGTATGAGATTCAAGAAGTTGTTGGAAAAGGAAGTTACGGCGTTGTTGCAGCTGCAGTCGACACACACACCGGTGAAAAAGTAGCCATTAAAAAATCAACGATGTCTTCGAGCATAAGAGAATTCAAAGACATTTATGTGGTTTTCGAGTTGATGGAATCTGATATTGATGAAGTCATCAAGGTTAACGATGACCTCACCCCTGAACATCATCAATT...

CDS

Download CDS FASTA

2541 bp · LXL04_020286|LXL04_020286|OH1004|CDS

ATGCTTGGCAAGGAATTTTTCACCGAGTATGGTGAAGCAAGTCTGTATGAGATTCAAGAAGTTGTTGGAAAAGGAAGTTACGGCGTTGTTGCAGCTGCAGTCGACACACACACCGGTGAAAAAGTAGCCATTAAAAAATCAACGATGTCTTCGAGCATAAGAGAATTCAAAGACATTTATGTGGTTTTCGAGTTGATGGAATCTGATATTGATGAAGTCATCAAGGTTAACGATGACCTCACCCCTGAACATCATCAATT...

Protein

Download Protein FASTA

846 aa · LXL04_020286|LXL04_020286|OH1004|PROTEIN

MLGKEFFTEYGEASLYEIQEVVGKGSYGVVAAAVDTHTGEKVAIKKSTMSSSIREFKDIYVVFELMESDIDEVIKVNDDLTPEHHQFFLYQLLRALKYIHTAHVFHRDLKPKNILANADCKLKICDFGLARASFDDTPSAIFWTDYVATRWYRAPELCGSFFSKYTSAIDIWSIGNVVHQLDLVTDLLGSPSPEIIARIRNDKARRYLNGLPNKVKVLLSNKFPNADPLALRLLEKLLAFDPADRISAEEISFSISGSIM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020286`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020286

Location Chr04:63800102-63807077 (-)

Description Similar to MPK15: Mitogen-activated protein kinase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73670`	Mitogen-activated protein kinase 15.	No verified direct reference in this release
`At3g18040`	Mitogen-activated protein kinase 9.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0135200`	Mitogen-activated protein kinase 13.	No verified direct reference in this release
`UniProt: A2X0M1`	Mitogen-activated protein kinase 13.	No verified direct reference in this release
`Os06g0708000`	May be involved in defense signaling pathway.	BWMK1, a rice mitogen-activated protein kinase, locates in the nucleus and mediates pathogenesis-related gene expression by activation of a transcription factor.2003 · DOI: 10.1104/pp.103.023176

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020286 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004707 MAP kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G73670

ath:AT3G18040

dosa:Os02g0135200

dosa:Os06g0708000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.383

Rank 1 · LXL04_020286 · OH-1004

Nucleus0.310

Rank 2 · LXL04_020286 · OH-1004

Endoplasmic reticulum0.145

Rank 3 · LXL04_020286 · OH-1004

Mitochondrion0.129

Rank 4 · LXL04_020286 · OH-1004

Cell membrane0.105

Rank 5 · LXL04_020286 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase49-251 aa

PF07714.24PK_Tyr_Ser-Thr57-179 aa

PF21530.4Pif1_2B_dom364-400 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020286	`PF00069.32`	Pkinase	49	251	1.6e-43	149.7
LXL04_020286	`PF07714.24`	PK_Tyr_Ser-Thr	57	179	1.2e-18	68.1
LXL04_020286	`PF21530.4`	Pif1_2B_dom	364	400	9.7e-17	61.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9U4`	Arabidopsis thaliana	Mitogen-activated protein kinase 15	57.336%	Swiss-Prot	weak database homology
`Q9LV37`	Arabidopsis thaliana	Mitogen-activated protein kinase 9	57.522%	Swiss-Prot	weak database homology
`Q0E459`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 13	54.927%	Swiss-Prot	weak database homology
`A2X0M1`	Oryza sativa subsp. indica	Mitogen-activated protein kinase 13	54.927%	Swiss-Prot	weak database homology
`Q5Z9J0`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 12	56.763%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card