LXL04_020134 | RubberDandelionOmics

Gene overview

LXL04_020134

Reference: OH-1004 Chr: Chr04 Coordinates: 52807902-52811466 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_020134|LXL04_020134|OH1004|cDNA

ATGTCTTTCTTATACACTTTTGACAAATGTGGCATAAGAAACCACCTTGATGTTCTCAGTGTCTCGCCACGCAACGACAACAGTCGCTGCCATTTCCAGACGAAAACTTTCAAAAAAGGGGCCGAAAGAAGAGGAGACATGTCTGGATACAGAGCCGAAGATGAGTATGATTACTTGTTCAAATTGGTACTAATCGGCGATTCTGGTGTTGGTAAATCCAATCTTCTTTCCAGGTTCACTAGAAACGAATTCAATTTAGA...

CDS

Download CDS FASTA

786 bp · LXL04_020134|LXL04_020134|OH1004|CDS

ATGTCTTTCTTATACACTTTTGACAAATGTGGCATAAGAAACCACCTTGATGTTCTCAGTGTCTCGCCACGCAACGACAACAGTCGCTGCCATTTCCAGACGAAAACTTTCAAAAAAGGGGCCGAAAGAAGAGGAGACATGTCTGGATACAGAGCCGAAGATGAGTATGATTACTTGTTCAAATTGGTACTAATCGGCGATTCTGGTGTTGGTAAATCCAATCTTCTTTCCAGGTTCACTAGAAACGAATTCAATTTAGA...

Protein

Download Protein FASTA

261 aa · LXL04_020134|LXL04_020134|OH1004|PROTEIN

MSFLYTFDKCGIRNHLDVLSVSPRNDNSRCHFQTKTFKKGAERRGDMSGYRAEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLETKSTIGVEFATRSLNVDGKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRRATFENMERWLKELRDHTDPNIVVMLIGNKSDLRHLLAVTTDDGKTLAEAESLYFMETSALEATNVENAFSEVITQIYRIVSKKAVEGGDAGSVPAKGSAIDVKDESVGPSRFGCCS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020134`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020134

Location Chr04:52807902-52811466 (+)

Description Similar to RAB11D: Ras-related protein Rab11D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18800`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0551400`	Possesses GTPase activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020134 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0015031 protein transport Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT4G18800

dosa:Os06g0551400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.414

Rank 1 · LXL04_020134 · OH-1004

Cytoplasm0.382

Rank 2 · LXL04_020134 · OH-1004

Cell membrane0.194

Rank 3 · LXL04_020134 · OH-1004

Endoplasmic reticulum0.188

Rank 4 · LXL04_020134 · OH-1004

Lysosome / Vacuole0.158

Rank 5 · LXL04_020134 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf60-218 aa

PF00071.29Ras61-221 aa

PF08477.20Roc61-175 aa

PF01926.30MMR_HSR162-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020134	`PF00025.28`	Arf	60	218	7.3e-13	49.1
LXL04_020134	`PF00071.29`	Ras	61	221	3.7e-62	209.4
LXL04_020134	`PF08477.20`	Roc	61	175	8.3e-35	120.3
LXL04_020134	`PF01926.30`	MMR_HSR1	62	167	3.4e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN35`	Arabidopsis thaliana	Ras-related protein RABA1d	80.556%	Swiss-Prot	strong database homology
`P40393`	Oryza sativa subsp. japonica	Ras-related protein RIC2	82.710%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card