LXL04_019964 | RubberDandelionOmics

Gene overview

LXL04_019964

Reference: OH-1004 Chr: Chr04 Coordinates: 46054323-46057460 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3018 bp · LXL04_019964|LXL04_019964|OH1004|cDNA

ATGCCACCGCCACGCCTGCCGTCGAGACCACCGTCGTCGCAACCTTCACGTTTATTGTTATTGTCtctactattattattatcagcCACCACCTCCCTCTCTTTGAACCAAGAAGGTATTGCATTAATCCACGTAAAATCCAGCCTCACCGACCCTGGTGGAATTCTCTCCGACTGGAACCCCGCCGACGACAAACCATGCAGTTGGACGGGCATCACCTGCAACGATTCCACCACCGTCACTGCCGTCAATCTCCCCTC...

CDS

Download CDS FASTA

3018 bp · LXL04_019964|LXL04_019964|OH1004|CDS

ATGCCACCGCCACGCCTGCCGTCGAGACCACCGTCGTCGCAACCTTCACGTTTATTGTTATTGTCTCTACTATTATTATTATCAGCCACCACCTCCCTCTCTTTGAACCAAGAAGGTATTGCATTAATCCACGTAAAATCCAGCCTCACCGACCCTGGTGGAATTCTCTCCGACTGGAACCCCGCCGACGACAAACCATGCAGTTGGACGGGCATCACCTGCAACGATTCCACCACCGTCACTGCCGTCAATCTCCCCTC...

Protein

Download Protein FASTA

1005 aa · LXL04_019964|LXL04_019964|OH1004|PROTEIN

MPPPRLPSRPPSSQPSRLLLLSLLLLLSATTSLSLNQEGIALIHVKSSLTDPGGILSDWNPADDKPCSWTGITCNDSTTVTAVNLPSASLSGPFPTSLCRLPSLSIVSLSNNDLNSSIPATISACRNLTYLDLSENYFDGLLPSTLADIPNLVYVDLQYNSFSGEIPPSFGLFRRLETLLLTNNLYNGSIPVILTNVTTLKELSLAYNYFLPGPIPPQFGNLSNIEHLWLSSCGFVGTIPETFSRLQKLSNLELSYNSLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019964`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019964

Location Chr04:46054323-46057460 (+)

Description Similar to HSL1: Receptor-like protein kinase HSL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28440`	Receptor-like protein kinase HSL1.	No verified direct reference in this release
`At4g28490`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission.	No verified direct reference in this release
`At5g65710`	Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission.	No verified direct reference in this release
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019964 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G28440

ath:AT4G28490

ath:AT4G28650

ath:AT5G49660

ath:AT5G65710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.873

Rank 1 · LXL04_019964 · OH-1004

Endoplasmic reticulum0.086

Rank 2 · LXL04_019964 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_019964 · OH-1004

Nucleus0.038

Rank 4 · LXL04_019964 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_019964 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_235-75 aa

PF13855.13LRR_8102-161 aa

PF23598.2LRR_14103-206 aa

PF23598.2LRR_14215-307 aa

PF13855.13LRR_8224-283 aa

PF13855.13LRR_8248-307 aa

PF23598.2LRR_14478-564 aa

PF13855.13LRR_8493-547 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019964	`PF08263.18`	LRRNT_2	35	75	4.5e-14	53.1
LXL04_019964	`PF13855.13`	LRR_8	102	161	1.7e-35	121.3
LXL04_019964	`PF23598.2`	LRR_14	103	206	3.1e-26	92.7
LXL04_019964	`PF23598.2`	LRR_14	215	307	3.1e-26	92.7
LXL04_019964	`PF13855.13`	LRR_8	224	283	1.7e-35	121.3
LXL04_019964	`PF13855.13`	LRR_8	248	307	1.7e-35	121.3
LXL04_019964	`PF23598.2`	LRR_14	478	564	3.1e-26	92.7
LXL04_019964	`PF13855.13`	LRR_8	493	547	1.7e-35	121.3
LXL04_019964	`PF00069.32`	Pkinase	698	968	2.4e-48	165.5
LXL04_019964	`PF07714.24`	PK_Tyr_Ser-Thr	699	970	2.1e-42	146.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGP2`	Arabidopsis thaliana	Receptor-like protein kinase HSL1	56.926%	Swiss-Prot	strong database homology
`P47735`	Arabidopsis thaliana	Receptor-like protein kinase 5	54.027%	Swiss-Prot	strong database homology
`C0LGX3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase HSL2	43.020%	Swiss-Prot	moderate database homology
`Q9M0G7`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 1	39.064%	Swiss-Prot	moderate database homology
`Q9FGL5`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR1	40.082%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card