LXL04_019809 | RubberDandelionOmics

Gene overview

LXL04_019809

Reference: OH-1004 Chr: Chr04 Coordinates: 40712007-40712384 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · LXL04_019809|LXL04_019809|OH1004|cDNA

ATGGTACGCTACTCCGGTCGTAAAATTAGTGGAGCGCTTGATGATTGGTTTTGGGTTAGTTTAGTGGAAAAAGTTACTGTAAACAAGCCTCGAGAGATGGATAAGGCGTTGAATACTTTGGTAAATAAGTTACAGGGGGAAGCTGCGGGAGGTAGTAAGAAGTATGCATCTGGGAATATGAGTTATGCGCCGGATTTGTTTTTAACAGTTCATGCGGTTATGCAATGTACTCCGGATTTATCGAAAGAGCAATGTAGTAA...

CDS

Download CDS FASTA

378 bp · LXL04_019809|LXL04_019809|OH1004|CDS

ATGGTACGCTACTCCGGTCGTAAAATTAGTGGAGCGCTTGATGATTGGTTTTGGGTTAGTTTAGTGGAAAAAGTTACTGTAAACAAGCCTCGAGAGATGGATAAGGCGTTGAATACTTTGGTAAATAAGTTACAGGGGGAAGCTGCGGGAGGTAGTAAGAAGTATGCATCTGGGAATATGAGTTATGCGCCGGATTTGTTTTTAACAGTTCATGCGGTTATGCAATGTACTCCGGATTTATCGAAAGAGCAATGTAGTAA...

Protein

Download Protein FASTA

125 aa · LXL04_019809|LXL04_019809|OH1004|PROTEIN

MVRYSGRKISGALDDWFWVSLVEKVTVNKPREMDKALNTLVNKLQGEAAGGSKKYASGNMSYAPDLFLTVHAVMQCTPDLSKEQCSKCLKSTIVTLLKCCSGKIAARVLSPSCYLRYDNEKFDKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019809`
TK1151 ID	TkA05G088840
OH-1004 ID	LXL04_019809
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 49.801 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019809

Location Chr04:40712007-40712384 (+)

Description Similar to CRK25: Cysteine-rich receptor-like protein kinase 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05200`	Cysteine-rich receptor-like protein kinase 25.	No verified direct reference in this release
`At4g21410`	Cysteine-rich receptor-like protein kinase 29.	No verified direct reference in this release
`At4g23220`	Cysteine-rich receptor-like protein kinase 14.	No verified direct reference in this release
`At5g48540`	Cysteine-rich repeat secretory protein 55.	No verified direct reference in this release
`At4g23190`	Cysteine-rich receptor-like protein kinase 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019809 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G05200

ath:AT4G21410

ath:AT4G23190

ath:AT4G23220

ath:AT5G48540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.592

Rank 1 · LXL04_019809 · OH-1004

Cell membrane0.307

Rank 2 · LXL04_019809 · OH-1004

Endoplasmic reticulum0.066

Rank 3 · LXL04_019809 · OH-1004

Cytoplasm0.061

Rank 4 · LXL04_019809 · OH-1004

Lysosome / Vacuole0.021

Rank 5 · LXL04_019809 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657.23Stress-antifung30-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019809	`PF01657.23`	Stress-antifung	30	120	5.5e-13	50.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0X5`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 25	33.871%	Swiss-Prot	moderate database homology
`Q8S9L6`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 29	33.333%	Swiss-Prot	moderate database homology
`Q8H199`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 14	31.783%	Swiss-Prot	moderate database homology
`Q9LV60`	Arabidopsis thaliana	Cysteine-rich repeat secretory protein 55	31.250%	Swiss-Prot	moderate database homology
`Q9ZP16`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 11	32.258%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card