LXL04_019782 | RubberDandelionOmics

Gene overview

LXL04_019782

Reference: OH-1004 Chr: Chr04 Coordinates: 40095417-40096934 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_019782|LXL04_019782|OH1004|cDNA

ATGGCAATCCAAAAACACATTAAACTTCTTGTGCAACTTCTAATAGTTGCACTTGCTTTTGGCATTGCCAATGGCCAGGGCTTAAAATTAGGGTTCTACCAAAAGACATGTCCGAGAGCTGAGGGCATTGTATGGAGGACAACCGCAAACCACATTTACCGAGCTCCTTCTCTTGCGGCTGCTTTGCTCCGAATGCACTTTCATGATTGTTTTGTTAGGGGATGTGATGGTTCGGTGCTATTAAACTCTACCAAAAATAA...

CDS

Download CDS FASTA

981 bp · LXL04_019782|LXL04_019782|OH1004|CDS

ATGGCAATCCAAAAACACATTAAACTTCTTGTGCAACTTCTAATAGTTGCACTTGCTTTTGGCATTGCCAATGGCCAGGGCTTAAAATTAGGGTTCTACCAAAAGACATGTCCGAGAGCTGAGGGCATTGTATGGAGGACAACCGCAAACCACATTTACCGAGCTCCTTCTCTTGCGGCTGCTTTGCTCCGAATGCACTTTCATGATTGTTTTGTTAGGGGATGTGATGGTTCGGTGCTATTAAACTCTACCAAAAATAA...

Protein

Download Protein FASTA

326 aa · LXL04_019782|LXL04_019782|OH1004|PROTEIN

MAIQKHIKLLVQLLIVALAFGIANGQGLKLGFYQKTCPRAEGIVWRTTANHIYRAPSLAAALLRMHFHDCFVRGCDGSVLLNSTKNNVAEKDGIPNLSIRGFQVIDAAKTAVEAACPGVVSCSDILALVARDAIHQIKGPYWPVPLGRRDGRVSIASETLTQLPAPFANITQLKANFASKGLSVKDLAVLSGGHTVGISHCSTITTRIYNFTGKGDTDPSIDPNYVPKLKSRCVPNDKTTLLSMDPGSTKSFDSDYYSVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019782`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019782

Location Chr04:40095417-40096934 (+)

Description Similar to PER27: Peroxidase 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01190`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g15180`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g05250`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g05240`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g05260`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019782 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009409 response to cold Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G05240

ath:AT1G05250

ath:AT1G05260

ath:AT3G01190

ath:AT5G15180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.599

Rank 1 · LXL04_019782 · OH-1004

Lysosome / Vacuole0.102

Rank 2 · LXL04_019782 · OH-1004

Cell membrane0.096

Rank 3 · LXL04_019782 · OH-1004

Cytoplasm0.074

Rank 4 · LXL04_019782 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_019782 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141.29peroxidase46-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019782	`PF00141.29`	peroxidase	46	288	3.6e-84	283.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43735`	Arabidopsis thaliana	Peroxidase 27	59.816%	Swiss-Prot	strong database homology
`Q9LXG3`	Arabidopsis thaliana	Peroxidase 56	56.113%	Swiss-Prot	strong database homology
`Q67Z07`	Arabidopsis thaliana	Peroxidase 2	57.426%	Swiss-Prot	strong database homology
`P0DI10`	Arabidopsis thaliana	Peroxidase 1	57.426%	Swiss-Prot	strong database homology
`O23044`	Arabidopsis thaliana	Peroxidase 3	54.348%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card