LXL04_019508 | RubberDandelionOmics

Gene overview

LXL04_019508

Reference: OH-1004 Chr: Chr04 Coordinates: 32757118-32761229 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1614 bp · LXL04_019508|LXL04_019508|OH1004|cDNA

ATGGCGGTGATTTTGGAGGATATAGTTAAAGCTGTGGAGGCATGGTTAAGGATTCTCAAGGAACCAGAACCCCACGTTGACCCGAATCTTGATCCAGTTCTTTTAGTTCCTGGGATTGCTGGTTCTATTCTCAATGCTAAAGATGCTGAAACTGGGAAAGAAGAGAGGGTTTGGGTTCGGATTTGGGAAGCTGATCGTGAATTCCGTGCCAAACTTTGGTGCAGATTCGATCCTGATTCTGGTAAAACCGTGTCTTTGGA...

CDS

Download CDS FASTA

1614 bp · LXL04_019508|LXL04_019508|OH1004|CDS

ATGGCGGTGATTTTGGAGGATATAGTTAAAGCTGTGGAGGCATGGTTAAGGATTCTCAAGGAACCAGAACCCCACGTTGACCCGAATCTTGATCCAGTTCTTTTAGTTCCTGGGATTGCTGGTTCTATTCTCAATGCTAAAGATGCTGAAACTGGGAAAGAAGAGAGGGTTTGGGTTCGGATTTGGGAAGCTGATCGTGAATTCCGTGCCAAACTTTGGTGCAGATTCGATCCTGATTCTGGTAAAACCGTGTCTTTGGA...

Protein

Download Protein FASTA

537 aa · LXL04_019508|LXL04_019508|OH1004|PROTEIN

MAVILEDIVKAVEAWLRILKEPEPHVDPNLDPVLLVPGIAGSILNAKDAETGKEERVWVRIWEADREFRAKLWCRFDPDSGKTVSLDPNISIVVPEDRDGLYAIDCLDPDMVIGRDNVCYFHDMINEMTSWGYQEGKTLFGFGYDFRQSNRLKETMDGLAEKLEAIYTASGGKKINVITHSMGGLLVKCFMTLHPDICEKYIKSWIAIAAPFQGAPGYVTSTLLNGMSFVDGLAAYFFVNKWSFHQLLIECPSIYELMAC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019508`
TK1151 ID	TkAUNG072210
OH-1004 ID	LXL04_019508
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019508

Location Chr04:32757118-32761229 (+)

Description Similar to LCAT4: Lecithin-cholesterol acyltransferase-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19860`	Lecithin-cholesterol acyltransferase-like 4.	No verified direct reference in this release
`At3g03310`	Hydrolyzes the sn-1 acylester bond of phospholipids.	Expression in yeast of a novel phospholipase A1 cDNA from Arabidopsis thaliana.2004 · DOI: 10.1111/j.1432-1033.2004.04317.x
`At1g27480`	Lecithin-cholesterol acyltransferase-like 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019508 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006644 phospholipid metabolic process Biological Process

GO:0006650 glycerophospholipid metabolic process Biological Process

GO:0006651 diacylglycerol biosynthetic process Biological Process

GO:0006658 phosphatidylserine metabolic process Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0009062 fatty acid catabolic process Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0034638 phosphatidylcholine catabolic process Biological Process

GO:0046338 phosphatidylethanolamine catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G27480

ath:AT3G03310

ath:AT4G19860

bta:282271

hsa:23659

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.338

Rank 1 · LXL04_019508 · OH-1004

Endoplasmic reticulum0.253

Rank 2 · LXL04_019508 · OH-1004

Golgi apparatus0.187

Rank 3 · LXL04_019508 · OH-1004

Lysosome / Vacuole0.172

Rank 4 · LXL04_019508 · OH-1004

Cell membrane0.160

Rank 5 · LXL04_019508 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02450.22LCAT82-397 aa

PF07819.20PGAP1166-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019508	`PF02450.22`	LCAT	82	397	1.7e-28	100.7
LXL04_019508	`PF07819.20`	PGAP1	166	219	1.7e-06	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q71N54`	Arabidopsis thaliana	Lecithin-cholesterol acyltransferase-like 4	61.825%	Swiss-Prot	strong database homology
`Q93V61`	Arabidopsis thaliana	Phospholipase A(1) LCAT3	50.372%	Swiss-Prot	strong database homology
`Q9FZI8`	Arabidopsis thaliana	Lecithin-cholesterol acyltransferase-like 1	24.942%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card