LXL04_019507 | RubberDandelionOmics

Gene overview

LXL04_019507

Reference: OH-1004 Chr: Chr04 Coordinates: 32748630-32752223 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2334 bp · LXL04_019507|LXL04_019507|OH1004|cDNA

ATGGAGAGCAGCGAAGAAGAAGACGATTTCCCAACTATCGAATCGGTCACTCCACAATCCAAGATCGACACCATCTACCAATCTAAAACCGAAAAGGGCATTAGAAAGCTCTGTTTTGAGCTTCTTGATTTAAAGGATGCAGTAGAGAATCTATGTGGCAACACTCAATCCAAATACTTAGCTTTTCTGAGGTTATCCGATGAGGTAGTGGAAATGGAACACGAACTCAATGACCTAAGAAAAAACATCTCTGCACAAGG...

CDS

Download CDS FASTA

2334 bp · LXL04_019507|LXL04_019507|OH1004|CDS

ATGGAGAGCAGCGAAGAAGAAGACGATTTCCCAACTATCGAATCGGTCACTCCACAATCCAAGATCGACACCATCTACCAATCTAAAACCGAAAAGGGCATTAGAAAGCTCTGTTTTGAGCTTCTTGATTTAAAGGATGCAGTAGAGAATCTATGTGGCAACACTCAATCCAAATACTTAGCTTTTCTGAGGTTATCCGATGAGGTAGTGGAAATGGAACACGAACTCAATGACCTAAGAAAAAACATCTCTGCACAAGG...

Protein

Download Protein FASTA

777 aa · LXL04_019507|LXL04_019507|OH1004|PROTEIN

MESSEEEDDFPTIESVTPQSKIDTIYQSKTEKGIRKLCFELLDLKDAVENLCGNTQSKYLAFLRLSDEVVEMEHELNDLRKNISAQGILIQDLQSGVHHELTQWARSTNTENPQKDTETDFLTESQDEKKSFLEKIDLLLSQHKVEEAIEAIETEERKHPDLKTSGPSLSNELIKRKSLIEDQILQIIEQTDLKKSVSGLLKLGKGPLGQQIFLKSKAARLQKNIQIFLPSCPCYPETFPATLSNIIFSTISQTTKEMGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019507`
TK1151 ID	TkAUNG072180
OH-1004 ID	LXL04_019507
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019507

Location Chr04:32748630-32752223 (-)

Description Similar to EXO84C: Exocyst complex component EXO84C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10180`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At1g10385`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At5g49830`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	The Arabidopsis exocyst complex is involved in cytokinesis and cell plate maturation.2010 · DOI: 10.1105/tpc.110.074351 A Framework for Lateral Membrane Trafficking and Polar Tethering of the PEN3 ATP-Binding Cassette Transporter.2016 · DOI: 10.1104/pp.16.01252

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019507 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0015031 protein transport Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0000145 exocyst Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005776 autophagosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G10180

ath:AT1G10385

ath:AT5G49830

gga:421531

xla:779171

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.542

Rank 1 · LXL04_019507 · OH-1004

Golgi apparatus0.219

Rank 2 · LXL04_019507 · OH-1004

Cell membrane0.211

Rank 3 · LXL04_019507 · OH-1004

Nucleus0.201

Rank 4 · LXL04_019507 · OH-1004

Lysosome / Vacuole0.141

Rank 5 · LXL04_019507 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16528.12Exo84_C131-325 aa

PF27696.1EXO84_helical358-523 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019507	`PF16528.12`	Exo84_C	131	325	1.6e-16	61.5
LXL04_019507	`PF27696.1`	EXO84_helical	358	523	1.7e-53	181.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY60`	Arabidopsis thaliana	Exocyst complex component EXO84C	56.327%	Swiss-Prot	strong database homology
`F4I4B6`	Arabidopsis thaliana	Exocyst complex component EXO84A	34.571%	Swiss-Prot	moderate database homology
`Q9LTB0`	Arabidopsis thaliana	Exocyst complex component EXO84B	33.237%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card