LXL04_019410 | RubberDandelionOmics

Gene overview

LXL04_019410

Reference: OH-1004 Chr: Chr04 Coordinates: 30691099-30695815 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · LXL04_019410|LXL04_019410|OH1004|cDNA

atgcggcaaactgagttgaattcctcctcaaacagtttctgctgctacatttgcacctgccaaagtgatcaagaagaagaagatgatgatgaatcagactccaagcaattgtcaaagtcaaattcaaagctggatgtgctgattcCAAGACCATACAAGCATCTACAACCagtATACTTCTTCTGTTTAGGCAAATATTCCTCTGCTGCTTTTCTGATGGCCACAAGACTTCAGTTTGAGAACAATTGTGAAATTGGGGT...

CDS

Download CDS FASTA

954 bp · LXL04_019410|LXL04_019410|OH1004|CDS

ATGCGGCAAACTGAGTTGAATTCCTCCTCAAACAGTTTCTGCTGCTACATTTGCACCTGCCAAAGTGATCAAGAAGAAGAAGATGATGATGAATCAGACTCCAAGCAATTGTCAAAGTCAAATTCAAAGCTGGATGTGCTGATTCCAAGACCATACAAGCATCTACAACCAGTATACTTCTTCTGTTTAGGCAAATATTCCTCTGCTGCTTTTCTGATGGCCACAAGACTTCAGTTTGAGAACAATTGTGAAATTGGGGT...

Protein

Download Protein FASTA

317 aa · LXL04_019410|LXL04_019410|OH1004|PROTEIN

MRQTELNSSSNSFCCYICTCQSDQEEEDDDESDSKQLSKSNSKLDVLIPRPYKHLQPVYFFCLGKYSSAAFLMATRLQFENNCEIGVFSKLTNAYCLVAIGGSENFYSTFESELADVIPVVKTSIGGTRIIGRLCIGNKNGLLLPHTTTDQELQHLRNSLPDAVVVQRIDERLSALGNCIACNDHVALTHTDLDRETEELIADVLGVEVFRQTIAGNVLVGSYCAFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019410`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019410

Location Chr04:30691099-30695815 (-)

Description Similar to EIF6-2: Eukaryotic translation initiation factor 6-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55620`	Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019410 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000054 ribosomal subunit export from nucleus Biological Process

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000470 maturation of LSU-rRNA Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032868 response to insulin Biological Process

GO:0035195 miRNA-mediated post-transcriptional gene silencing Biological Process

GO:0035278 miRNA-mediated gene silencing by inhibition of translation Biological Process

GO:0042256 cytosolic ribosome assembly Biological Process

GO:0042304 regulation of fatty acid biosynthetic process Biological Process

GO:0045727 positive regulation of translation Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

KEGG gene cross-reference

ath:AT3G55620

bta:286811

hsa:3692

mmu:16418

rno:305506

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · LXL04_019410 · OH-1004

Nucleus0.317

Rank 2 · LXL04_019410 · OH-1004

Mitochondrion0.104

Rank 3 · LXL04_019410 · OH-1004

Cell membrane0.093

Rank 4 · LXL04_019410 · OH-1004

Endoplasmic reticulum0.086

Rank 5 · LXL04_019410 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01912.25eIF-675-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019410	`PF01912.25`	eIF-6	75	293	6.2e-92	307.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M060`	Arabidopsis thaliana	Eukaryotic translation initiation factor 6-2	91.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card