LXL04_019400 | RubberDandelionOmics

Gene overview

LXL04_019400

Reference: OH-1004 Chr: Chr04 Coordinates: 30512567-30518480 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3072 bp · LXL04_019400|LXL04_019400|OH1004|cDNA

ATGGCCGGTGGGGTAGCAAATATGGATCAGTTCGAGTTGTACTTTAGGAGAGCAGATTTAGATCAAGATGGACGCGTTAGTGGCGGCGAAGCTGTTTCCTTCTTCCAAGCCTCTGGTTTACCTAAGTCGGTACTCGCTCAGATATGGACAATTGCTGATCAAAACCGAACCGGTTACCTTGGTCGACCAGAGTTCTTCAATTATCTAAAACTTGTAACTGTTGCACAAAGCAAACGGGACCTCACTCCAGATATTGTGAA...

CDS

Download CDS FASTA

3072 bp · LXL04_019400|LXL04_019400|OH1004|CDS

ATGGCCGGTGGGGTAGCAAATATGGATCAGTTCGAGTTGTACTTTAGGAGAGCAGATTTAGATCAAGATGGACGCGTTAGTGGCGGCGAAGCTGTTTCCTTCTTCCAAGCCTCTGGTTTACCTAAGTCGGTACTCGCTCAGATATGGACAATTGCTGATCAAAACCGAACCGGTTACCTTGGTCGACCAGAGTTCTTCAATTATCTAAAACTTGTAACTGTTGCACAAAGCAAACGGGACCTCACTCCAGATATTGTGAA...

Protein

Download Protein FASTA

1023 aa · LXL04_019400|LXL04_019400|OH1004|PROTEIN

MAGGVANMDQFELYFRRADLDQDGRVSGGEAVSFFQASGLPKSVLAQIWTIADQNRTGYLGRPEFFNYLKLVTVAQSKRDLTPDIVKAALYGPASAKIPAPQINLGALPPGPLPPQMGSTGTPSVRGPQPQGYPNPPQQSQTMRPPQSTLPTTTFPSQQGGMMLAPSGSSLSAPPRPQGVGPTNLLQNAAPKPNGTYLSGSSGPSVAGNGIVSSSAFGGGFTAPPSQAKNNPVVAVSSASGGPQLPNKPPAQVFQNVGNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019400`
TK1151 ID	TkA05G049260
OH-1004 ID	LXL04_019400
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019400`
Location	Chr04:30512567-30518480 (+)
Description	Similar to SPBC800.10c: Uncharacterized calcium-binding protein C800.10c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019400` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0006897 endocytosis Biological Process GO:0016197 endosomal transport Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005905 clathrin-coated pit Cellular Component GO:0005938 cell cortex Cellular Component GO:0010008 endosome membrane Cellular Component GO:0032153 cell division site Cellular Component GO:0035838 growing cell tip Cellular Component
KEGG gene cross-reference	mgr:MGG_12839 mmu:19707 spo:2540824 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.720

Rank 1 · LXL04_019400 · OH-1004

Golgi apparatus0.187

Rank 2 · LXL04_019400 · OH-1004

Nucleus0.184

Rank 3 · LXL04_019400 · OH-1004

Cell membrane0.090

Rank 4 · LXL04_019400 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_019400 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12763.14EH11-77 aa

PF13499.13EF-hand_714-69 aa

PF12763.14EH290-364 aa

PF13499.13EF-hand_7299-355 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019400	`PF12763.14`	EH	11	77	9e-26	90.5
LXL04_019400	`PF13499.13`	EF-hand_7	14	69	2.5e-12	47.7
LXL04_019400	`PF12763.14`	EH	290	364	9e-26	90.5
LXL04_019400	`PF13499.13`	EF-hand_7	299	355	2.5e-12	47.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card