LXL04_019348 | RubberDandelionOmics

Gene overview

LXL04_019348

Reference: OH-1004 Chr: Chr04 Coordinates: 29425636-29434824 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

8400 bp · LXL04_019348|LXL04_019348|OH1004|cDNA

ATGAGCAGCAGCAGAATAAGAAACTTCCGTCGTCGATCAGACGACGACGACAATGACGATGAAGATAAAGAAAAAACAACCACCCCTGCCGCCCCCACCACCATCAGCAAAAAACAACAATCAAAGCCTGCCACAGCCACTCCAAAACCTAAGAAACCTAGTCTCCTTAGCTTTGCCGATGACGAATCTACGGACTTCATTACTCCAATCTCTCGAAGCCGCCCTTCTAATCCAAATAAACATCCTAGTTCTTCCCGTTT...

CDS

Download CDS FASTA

8400 bp · LXL04_019348|LXL04_019348|OH1004|CDS

ATGAGCAGCAGCAGAATAAGAAACTTCCGTCGTCGATCAGACGACGACGACAATGACGATGAAGATAAAGAAAAAACAACCACCCCTGCCGCCCCCACCACCATCAGCAAAAAACAACAATCAAAGCCTGCCACAGCCACTCCAAAACCTAAGAAACCTAGTCTCCTTAGCTTTGCCGATGACGAATCTACGGACTTCATTACTCCAATCTCTCGAAGCCGCCCTTCTAATCCAAATAAACATCCTAGTTCTTCCCGTTT...

Protein

Download Protein FASTA

2799 aa · LXL04_019348|LXL04_019348|OH1004|PROTEIN

MSSSRIRNFRRRSDDDDNDDEDKEKTTTPAAPTTISKKQQSKPATATPKPKKPSLLSFADDESTDFITPISRSRPSNPNKHPSSSRLSKPSPLSSSSAHKLTSAKDRNSAKERTSASSLPSNVQPQAGVYTKEALLELQKNTKTLGSSTSRSRPCPPPSEPIIVLKGTVKPIIDDSLTNTKEGDEESDRDETMNRLGSIQLGGKLRKGGNLDGGVIPDQAMIDAIRAKRERLRQSRAAAPDFIALDGGSNHGEAEGLSDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019348`
TK1151 ID	TkA05G045120
OH-1004 ID	LXL04_019348
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	68.900
Protein coverage (%)	TK1151 100.000 / OH-1004 53.591 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019348

Location Chr04:29425636-29434824 (+)

Description Similar to ILP1: Transcriptional repressor ILP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08550`	Transcriptional repressor regulating endoreduplication through control of A-type cyclins expression.	Increased level of polyploidy1, a conserved repressor of CYCLINA2 transcription, controls endoreduplication in Arabidopsis.2006 · DOI: 10.1105/tpc.106.043869

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019348 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030371 translation repressor activity Molecular Function

KEGG gene cross-reference

ath:AT5G08550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · LXL04_019348 · OH-1004

Nucleus0.474

Rank 2 · LXL04_019348 · OH-1004

Mitochondrion0.032

Rank 3 · LXL04_019348 · OH-1004

Endoplasmic reticulum0.032

Rank 4 · LXL04_019348 · OH-1004

Cell membrane0.029

Rank 5 · LXL04_019348 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15458.12NTR2201-329 aa

PF15458.12NTR2596-730 aa

PF15458.12NTR21327-1463 aa

PF15458.12NTR21746-1882 aa

PF15458.12NTR22145-2262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019348	`PF15458.12`	NTR2	201	329	5.2e-35	121.9
LXL04_019348	`PF15458.12`	NTR2	596	730	5.2e-35	121.9
LXL04_019348	`PF15458.12`	NTR2	1327	1463	5.2e-35	121.9
LXL04_019348	`PF15458.12`	NTR2	1746	1882	5.2e-35	121.9
LXL04_019348	`PF15458.12`	NTR2	2145	2262	5.2e-35	121.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN3`	Arabidopsis thaliana	Transcriptional repressor ILP1	53.005%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card