LXL04_019332 | RubberDandelionOmics

Gene overview

LXL04_019332

Reference: OH-1004 Chr: Chr04 Coordinates: 29053799-29056337 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1590 bp · LXL04_019332|LXL04_019332|OH1004|cDNA

ATGCTCCGTCGTCCTTTGATCATCGGCATACATTTGTTCGTAAAACGGCTGGCCCGCTCATGTTTTCCCGATAGCGTTATGCAATTTCCAACATTCTCATTGGTATCTCCAAGTGTTAGGATTAGGTTTAGGAGTAGGTTTTCGAACAGAATGGAACCTTCTGGTGTTAATTCAGACGCGCACAGAGGTTCGTTGGCAAGCACCAGTACCAGTGATCATCAGCATAATCATCCACGACGGCAAAATGGAAACAACCCTTT...

CDS

Download CDS FASTA

1590 bp · LXL04_019332|LXL04_019332|OH1004|CDS

ATGCTCCGTCGTCCTTTGATCATCGGCATACATTTGTTCGTAAAACGGCTGGCCCGCTCATGTTTTCCCGATAGCGTTATGCAATTTCCAACATTCTCATTGGTATCTCCAAGTGTTAGGATTAGGTTTAGGAGTAGGTTTTCGAACAGAATGGAACCTTCTGGTGTTAATTCAGACGCGCACAGAGGTTCGTTGGCAAGCACCAGTACCAGTGATCATCAGCATAATCATCCACGACGGCAAAATGGAAACAACCCTTT...

Protein

Download Protein FASTA

529 aa · LXL04_019332|LXL04_019332|OH1004|PROTEIN

MLRRPLIIGIHLFVKRLARSCFPDSVMQFPTFSLVSPSVRIRFRSRFSNRMEPSGVNSDAHRGSLASTSTSDHQHNHPRRQNGNNPFSASNFFRSPVCTFLEYMGVLPTSNSDSSVNLINSGRTWNESHPSVDDSSEVSIRIAGSREQDINQSSTAGQIREGTATQSESSVEVQSISRAVSAASMDTQGDSRSEHGGGVSGNGDVEAADGVGVNNNRDSTYQRYDLQQLARMAEQILPFSLLLSVVFIRQHFEGIPDFLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019332`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019332`
Location	Chr04:29053799-29056337 (+)
Description	Similar to RNFT2: RING finger and transmembrane domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019332` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:1904294 positive regulation of ERAD pathway Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	hsa:84900 mmu:269695 pon:100174460 xla:414607 xtr:549103 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.563

Rank 1 · LXL04_019332 · OH-1004

Nucleus0.209

Rank 2 · LXL04_019332 · OH-1004

Golgi apparatus0.175

Rank 3 · LXL04_019332 · OH-1004

Cytoplasm0.134

Rank 4 · LXL04_019332 · OH-1004

Cell membrane0.076

Rank 5 · LXL04_019332 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12678.14zf-rbx1465-506 aa

PF13920.13zf-C3HC4_3466-509 aa

PF13639.13zf-RING_2468-506 aa

PF00097.32zf-C3HC4468-505 aa

PF13923.13zf-C3HC4_2468-505 aa

PF13445.13zf-RING_UBOX468-503 aa

PF14634.13zf-RING_5468-506 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019332	`PF12678.14`	zf-rbx1	465	506	2.4e-07	31.6
LXL04_019332	`PF13920.13`	zf-C3HC4_3	466	509	2.7e-09	37.4
LXL04_019332	`PF13639.13`	zf-RING_2	468	506	1.4e-10	42.0
LXL04_019332	`PF00097.32`	zf-C3HC4	468	505	2e-09	37.9
LXL04_019332	`PF13923.13`	zf-C3HC4_2	468	505	2.2e-09	37.7
LXL04_019332	`PF13445.13`	zf-RING_UBOX	468	503	1.3e-08	35.4
LXL04_019332	`PF14634.13`	zf-RING_5	468	506	5.6e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card