LXL04_019287 | RubberDandelionOmics

Gene overview

LXL04_019287

Reference: OH-1004 Chr: Chr04 Coordinates: 28151087-28153643 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2412 bp · LXL04_019287|LXL04_019287|OH1004|cDNA

ATGTCTCGTCTACCGGCCATAGTATCATCGGAGGGATACGTCCCCGGAGTCAACGAACCAGAACAAATGATTTGTCAGTATCTCCACATGACCAATTCCATGGGATGTTCATGGTTCGGATGCGATATCTCCGCCTTCAGCTTACCCCTTTTAATGCTCCAGCTCAGCATCATCTTCATCGTCTCGCAAACCACCTTCTTCCTCCTCAAACCCCTTCGACAAAGTATTCTCTCTTGCCAACTTATCGGTTGTATTGTGTT...

CDS

Download CDS FASTA

2412 bp · LXL04_019287|LXL04_019287|OH1004|CDS

ATGTCTCGTCTACCGGCCATAGTATCATCGGAGGGATACGTCCCCGGAGTCAACGAACCAGAACAAATGATTTGTCAGTATCTCCACATGACCAATTCCATGGGATGTTCATGGTTCGGATGCGATATCTCCGCCTTCAGCTTACCCCTTTTAATGCTCCAGCTCAGCATCATCTTCATCGTCTCGCAAACCACCTTCTTCCTCCTCAAACCCCTTCGACAAAGTATTCTCTCTTGCCAACTTATCGGTTGTATTGTGTT...

Protein

Download Protein FASTA

803 aa · LXL04_019287|LXL04_019287|OH1004|PROTEIN

MSRLPAIVSSEGYVPGVNEPEQMICQYLHMTNSMGCSWFGCDISAFSLPLLMLQLSIIFIVSQTTFFLLKPLRQSILSCQLIGCIVFMSFLRLDTHLLNQLFPESGKLVLDTVANFGFMLHVFVVGVQIDTNILKSVQRHVVLIGFMSFFLPYAVCILCIVPLPNLIQLDEFSFHTLPFVAALTSMTTFAAVTTTLSDLNLLNSDLGRLSCSTALVTDSCSYITTLALTTIGIALERSDWKPVRNVLYIVCFLFTICFVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019287`
TK1151 ID	TkA05G038220
OH-1004 ID	LXL04_019287
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 89.166 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019287

Location Chr04:28151087-28153643 (-)

Description Similar to CHX14: Cation/H(+) antiporter 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06970`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At2g30240`	High-affinity potassium transporter that plays a role in K(+) acquisition.	No verified direct reference in this release
`At2g13620`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At5g41610`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At5g22900`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019287 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005770 late endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G06970

ath:AT2G13620

ath:AT2G30240

ath:AT5G22900

ath:AT5G41610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.814

Rank 1 · LXL04_019287 · OH-1004

Endoplasmic reticulum0.104

Rank 2 · LXL04_019287 · OH-1004

Cytoplasm0.081

Rank 3 · LXL04_019287 · OH-1004

Lysosome / Vacuole0.045

Rank 4 · LXL04_019287 · OH-1004

Golgi apparatus0.032

Rank 5 · LXL04_019287 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999.27Na_H_Exchanger68-442 aa

PF23256.2CHX17_2nd502-626 aa

PF23259.2CHX17_C642-785 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019287	`PF00999.27`	Na_H_Exchanger	68	442	1e-36	127.4
LXL04_019287	`PF23256.2`	CHX17_2nd	502	626	4.3e-39	134.2
LXL04_019287	`PF23259.2`	CHX17_C	642	785	8.1e-32	111.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMJ1`	Arabidopsis thaliana	Cation/H(+) antiporter 14	37.084%	Swiss-Prot	moderate database homology
`O22920`	Arabidopsis thaliana	Cation/H(+) symporter 13	33.418%	Swiss-Prot	moderate database homology
`Q9SIT5`	Arabidopsis thaliana	Cation/H(+) antiporter 15	31.368%	Swiss-Prot	moderate database homology
`Q9FFR9`	Arabidopsis thaliana	Cation/H(+) antiporter 18	29.215%	Swiss-Prot	weak database homology
`Q9FFB8`	Arabidopsis thaliana	Cation/H(+) antiporter 3	27.887%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card