LXL04_019283 | RubberDandelionOmics

Gene overview

LXL04_019283

Reference: OH-1004 Chr: Chr04 Coordinates: 28133020-28134393 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

972 bp · LXL04_019283|LXL04_019283|OH1004|cDNA

ATGGGAAATGAGAGGTCGAATAGTTATTGGGAAGCAAATCTACCACCAAATTATGATAGGGTTGGCATTGAAAATTTCATTCGTTCAAAataTGAAGATAAAAGATGGGTTGCTAAAGAAGGAAGAGAAATACCACCTCCTGCTCCTATAGTGCAACAACAACAAGAAAAAGCACATGTTCAGTGGCAAAGAACTGCTGAAAAAACCAGTCTTCTTGTGCCTCCAAAAGAACCTGAACTTAAAATGTCTGGGAAAATTCG...

CDS

Download CDS FASTA

972 bp · LXL04_019283|LXL04_019283|OH1004|CDS

ATGGGAAATGAGAGGTCGAATAGTTATTGGGAAGCAAATCTACCACCAAATTATGATAGGGTTGGCATTGAAAATTTCATTCGTTCAAAATATGAAGATAAAAGATGGGTTGCTAAAGAAGGAAGAGAAATACCACCTCCTGCTCCTATAGTGCAACAACAACAAGAAAAAGCACATGTTCAGTGGCAAAGAACTGCTGAAAAAACCAGTCTTCTTGTGCCTCCAAAAGAACCTGAACTTAAAATGTCTGGGAAAATTCG...

Protein

Download Protein FASTA

323 aa · LXL04_019283|LXL04_019283|OH1004|PROTEIN

MGNERSNSYWEANLPPNYDRVGIENFIRSKYEDKRWVAKEGREIPPPAPIVQQQQEKAHVQWQRTAEKTSLLVPPKEPELKMSGKIRNKMYNLDQKCKTKIWLAFSARREASGTFHRRSLGRLSICYCTTTTTTTTTSGIEDLFKDSPPVPVATSHQPLPEKDMKNDIMSLFEKSNNNNTTSPYAVHQQQLAMLAQQQYLIMAAAAKSGGLPNLNGNGQNGNLQNNWGNVGYQFPGMVKSICNSLHGENKQMGNMGAHNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019283`
TK1151 ID	TkA05G038150
OH-1004 ID	LXL04_019283
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 87.000 / OH-1004 26.935 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019283

Location Chr04:28133020-28134393 (+)

Description Similar to AGD5: ADP-ribosylation factor GTPase-activating protein AGD5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54310`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	AGD5 is a GTPase-activating protein at the trans-Golgi network.2010 · DOI: 10.1111/j.1365-313x.2010.04369.x
`At3g17660`	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010227 floral organ abscission Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0035652 clathrin-coated vesicle cargo loading Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0060866 leaf abscission Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G17660

ath:AT5G54310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.521

Rank 1 · LXL04_019283 · OH-1004

Cytoplasm0.469

Rank 2 · LXL04_019283 · OH-1004

Cell membrane0.060

Rank 3 · LXL04_019283 · OH-1004

Mitochondrion0.045

Rank 4 · LXL04_019283 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_019283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL69`	Arabidopsis thaliana	ADP-ribosylation factor GTPase-activating protein AGD5	43.781%	Swiss-Prot	moderate database homology
`Q0WQQ1`	Arabidopsis thaliana	Probable ADP-ribosylation factor GTPase-activating protein AGD15	46.154%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card