LXL04_019209 | RubberDandelionOmics

Gene overview

LXL04_019209

Reference: OH-1004 Chr: Chr04 Coordinates: 26627361-26629445 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · LXL04_019209|LXL04_019209|OH1004|cDNA

ATGGCATCATTCTCATCGTCACCACCGCCGGCCAAGAGTCCAGCACCTACAGCGCCACCAGAGACTGACAACCCTGATCAGACGCAAACGCCTCTACCTCCTCCGCCAGGATACGGCGTCACCGGAATCCTCACACGATGGAGGCATGAAGACACACTTAAAAGAGTATCTCTAGGATTGAGAATTCTAGGTTTTGTTTTCTCGATGCTTGCGTTCATAATCATGGCTAGTAACAAGCATGGCCGTGGGAGAAATTTCGA...

CDS

Download CDS FASTA

606 bp · LXL04_019209|LXL04_019209|OH1004|CDS

ATGGCATCATTCTCATCGTCACCACCGCCGGCCAAGAGTCCAGCACCTACAGCGCCACCAGAGACTGACAACCCTGATCAGACGCAAACGCCTCTACCTCCTCCGCCAGGATACGGCGTCACCGGAATCCTCACACGATGGAGGCATGAAGACACACTTAAAAGAGTATCTCTAGGATTGAGAATTCTAGGTTTTGTTTTCTCGATGCTTGCGTTCATAATCATGGCTAGTAACAAGCATGGCCGTGGGAGAAATTTCGA...

Protein

Download Protein FASTA

201 aa · LXL04_019209|LXL04_019209|OH1004|PROTEIN

MASFSSSPPPAKSPAPTAPPETDNPDQTQTPLPPPPGYGVTGILTRWRHEDTLKRVSLGLRILGFVFSMLAFIIMASNKHGRGRNFDEYEEYRYALAIAILSTLYTGLQSWRQIYEMSSGKEIIAARNLALIDFFGDQIIAYLLISAASSAVPMTNRMREGADNIFTDSSAACISMEFLAFFVLGLSAMLSGYKLAQKTYM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019209`
TK1151 ID	TkA05G030310
OH-1004 ID	LXL04_019209
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019209

Location Chr04:26627361-26629445 (+)

Description Similar to ARALYDRAFT_321547: CASP-like protein 4B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38480`	CASP-like protein 4B1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0344400`	CASP-like protein 4B4.	No verified direct reference in this release
`Os03g0817100`	CASP-like protein 4B3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019209 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

aly:9315816

ath:AT2G38480

dosa:Os03g0817100

dosa:Os05g0344400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.886

Rank 1 · LXL04_019209 · OH-1004

Cytoplasm0.077

Rank 2 · LXL04_019209 · OH-1004

Endoplasmic reticulum0.069

Rank 3 · LXL04_019209 · OH-1004

Nucleus0.039

Rank 4 · LXL04_019209 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_019209 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04535.18CASP_dom52-183 aa

PF01284.29MARVEL57-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019209	`PF04535.18`	CASP_dom	52	183	4.6e-28	98.6
LXL04_019209	`PF01284.29`	MARVEL	57	189	2.5e-07	31.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LE26`	Arabidopsis thaliana	CASP-like protein 4B1	51.053%	Swiss-Prot	strong database homology
`Q5W6M3`	Oryza sativa subsp. japonica	CASP-like protein 4B4	51.235%	Swiss-Prot	strong database homology
`B9F6Z0`	Oryza sativa subsp. japonica	CASP-like protein 4B3	51.250%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card